EY756102

Overview
NameEY756102
Unique NameEY756102
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length851
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9412 contig Csv1_Contig9412:133..983. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: TRNH_DATST (Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 1.028e-83
Identity = 153/256 (59.77%), Postives = 195/256 (76.17%), Query Frame = 3
Query:   12 RWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLIDSIEKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDGRYFGDGF 779
            RWSL+GMTALVTGGTRGIG+AIVEEL  FGA V+TCSR++ +L+E +++W+ KG KVSG  CD+   ++RQ LME+V S F+GKLNIL+NNAGTTIPKEAT FT ED+S IM TNFE++Y+L QLA+PLLKASGN +I+F SS  GVIAVPL SIYA++KGA+NQ+TK+LACEW KD+IRVNA APWII T +I++  + P   ++              E +EVSS V +     ASY+TGQ+ C+DG Y  +GF
Sbjct:   12 RWSLRGMTALVTGGTRGIGYAIVEELANFGAEVYTCSRSQNDLDECLEKWRRKGFKVSGPVCDVSSISQRQTLMESVTSSFNGKLNILINNAGTTIPKEATNFTAEDYSIIMGTNFEASYNLCQLAHPLLKASGNASIVFNSSAAGVIAVPLSSIYAASKGAINQVTKSLACEWAKDSIRVNAVAPWIINTPIIEAACQVPSQKKNIESLIGRAPMKRAGEPSEVSSLVTYLCLPTASYITGQIICVDGGYTVNGF 267          
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: TRN1_DATST (Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.007e-79
Identity = 148/256 (57.81%), Postives = 188/256 (73.44%), Query Frame = 3
Query:   12 RWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLID-SIEKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDGRYFGDG 776
            RWSLKG TALVTGG++GIG+AIVEEL   GA V+TCSRNE EL+E ++ W+ KGL V GS CDL  R ER KLM+TV   FDGKLNILVNNAG  I KEA +FT +D++ IM TNFE+AYHLSQ+AYPLLKAS NGN+IF+SS+ G  A+P  S+Y+++KGA+NQ+TK+LACEW KDNIRVN+ AP +I T L++ +I+K+P   E               +  EVS+ +AF  F AASY+TGQ+   DG +  +G
Sbjct:   16 RWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG 271          
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: TRN2_DATST (Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.542e-76
Identity = 141/249 (56.63%), Postives = 182/249 (73.09%), Query Frame = 3
Query:   12 RWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLIDSIEKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDG 758
            RW+L+G TALVTGG+RGIG+ IVEEL + GA V+TCSRN+ ELN+ + +W+SKG KV  S CDL  R+ERQ+LM TV + F GKLNILVNNAG  I KEA ++T+ED+S IM+ NFE+AYHLS LA+P LKAS  GN++FISSV+G +AVP  ++Y +TKGAM+QLT+ LA EW KDNIRVN   P +I TSL++   +DP   E+ +            E  E+++ VAF  F AASYVTGQ+  +DG
Sbjct:    4 RWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDG 252          
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: TRNH1_ARATH (Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 2.296e-75
Identity = 142/256 (55.47%), Postives = 177/256 (69.14%), Query Frame = 3
Query:   12 RWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLIDSIEKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDGRYFGDGF 779
            RWSLK  T LVTGGT+GIGHAIVEE   FGA++HTC+RNE ELNE + +W+ KG +V+GS CD  +R ER+KLM+TV S F GKL+IL+NN G    K   ++T EDFS  ++TN ESAYHLSQLA+PLLKASG GNIIF+SS+ GV++  + SIY++TKGA+NQL +NLACEW  D IR NA AP +I T L +++  D    E               E  EVSS VAF    AASY+TGQ  C+DG    +GF
Sbjct:    9 RWSLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQKKGFQVTGSVCDASLRPEREKLMQTVSSMFGGKLDILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWASDGIRANAVAPAVIATPLAEAVYDD----EFKKVVISRKPLGRFGEPEEVSSLVAFLCMPAASYITGQTICVDGGLTVNGF 260          
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: TRN2_HYONI (Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 3.315e-74
Identity = 137/255 (53.73%), Postives = 181/255 (70.98%), Query Frame = 3
Query:   12 RWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLIDSIEKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDGRYFGDG 776
            RW+L+G TALVTGG+RGIG+ IVEEL   GA V+TCSRN+ EL+E + +W+SKG  V  S CDL  R+ER++ M+TV + F GKLNILVNNAG  I KEA ++TMED+S IM+ NFE+AYHLS LA+P LKAS  GN++FISS++G  A+P  ++Y +TKGAM+QLT+ LA EW KDNIRVN   P +I TS+++   +DP   E+              E  E+++ VAF  F AASYVTGQ+  +DG +  +G
Sbjct:    4 RWNLEGCTALVTGGSRGIGYGIVEELANLGASVYTCSRNQKELDECLTQWRSKGFNVEASVCDLSSRSEREEFMKTVSNHFHGKLNILVNNAGIVIYKEAKDYTMEDYSHIMSINFEAAYHLSVLAHPFLKASERGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSMVEMTIQDPEQKENLDKLIDRCALRRMGEPKELAAVVAFLCFPAASYVTGQIIYVDGGFMANG 258          
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: GNO_GLUOX (Gluconate 5-dehydrogenase OS=Gluconobacter oxydans GN=gno PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 4.390e-26
Identity = 76/250 (30.40%), Postives = 125/250 (50.00%), Query Frame = 3
Query:   15 WSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCS-EFD-GKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLIDSIEKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDG 758
            +SL G  ALVTG +RGIG  + + L  +GA V    RN   L+     ++++GLK S +  D+    ++  +++ V + E D G ++IL+NNAG        EF+ +D+  +M+TN  + + + Q     +   G G I+ I SV   +A P  + Y +TKGA+  LTK +A +WG+  +++N  AP    T + + +  D    E               +  E+     F    A+S+V GQV  +DG
Sbjct:    7 FSLSGARALVTGASRGIGLTLAKGLARYGAEVVLNGRNAESLDSAQSGFEAEGLKASTAVFDV---TDQDAVIDGVAAIERDMGPIDILINNAGIQRRAPLEEFSRKDWDDLMSTNVNAVFFVGQAVARHMIPRGRGKIVNICSVQSELARPGIAPYTATKGAVKNLTKGMATDWGRHGLQINGLAPGYFATEMTERLVADE---EFTDWLCKRTPAGRWGQVEELVGAAVFLSSRASSFVNGQVLMVDG 250          
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: FABG_BACSU (3-oxoacyl-[acyl-carrier-protein] reductase OS=Bacillus subtilis GN=fabG PE=3 SV=3)

HSP 1 Score: 110.538 bits (275), Expect = 1.196e-23
Identity = 79/247 (31.98%), Postives = 117/247 (47.37%), Query Frame = 3
Query:   21 LKGMTALVTGGTRGIGHAIVEELTAFGA-IVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLIDSIEKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDG 758
            L   TA+VTG +RGIG +I  +L   GA +V   S NE + NE + E KS G K      D+    + Q +++   S F   ++ILVNNAG T          +++  ++  N +  ++ ++     +    +G II +SS+ GV   P  + Y + K  +  LTK+ A E    NI VNA AP  I T + D + KD +                  E ++VSS V F     A Y+TGQ   IDG
Sbjct:    2 LNDKTAIVTGASRGIGRSIALDLAKSGANVVVNYSGNEAKANEVVDEIKSMGRKAIAVKADVSNPEDVQNMIKETLSVFS-TIDILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNCTKAVTRQMMKQRSGRIINVSSIVGVSGNPGQANYVAAKAGVIGLTKSSAKELASRNITVNAIAPGFISTDMTDKLAKDVQ-----DEMLKQIPLARFGEPSDVSSVVTFLASEGARYMTGQTLHIDG 242          
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: HDHA_ECOLI (7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.934e-23
Identity = 77/249 (30.92%), Postives = 118/249 (47.39%), Query Frame = 3
Query:   21 LKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLIDSI---EKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDG 758
            L G  A++TG   GIG  I       GA V     N    N  + E +  G +     CD+    E   L +   S+  GK++ILVNNAG   PK   +  M DF      N  S +HLSQL  P ++ +G G I+ I+S+         + YAS+K A + L +N+A + G+ NIRVN  AP  I T  + S+   E + ++++H              +  ++++   F    AAS+V+GQ+  + G
Sbjct:    9 LDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKL-GKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHT-------PIRRLGQPQDIANAALFLCSPAASWVSGQILTVSG 248          
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: HDHA_ECO57 (7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.934e-23
Identity = 77/249 (30.92%), Postives = 118/249 (47.39%), Query Frame = 3
Query:   21 LKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLIDSI---EKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDG 758
            L G  A++TG   GIG  I       GA V     N    N  + E +  G +     CD+    E   L +   S+  GK++ILVNNAG   PK   +  M DF      N  S +HLSQL  P ++ +G G I+ I+S+         + YAS+K A + L +N+A + G+ NIRVN  AP  I T  + S+   E + ++++H              +  ++++   F    AAS+V+GQ+  + G
Sbjct:    9 LDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKL-GKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHT-------PIRRLGQPQDIANAALFLCSPAASWVSGQILTVSG 248          
BLAST of EY756102 vs. ExPASy Swiss-Prot
Match: DHRS4_BOVIN (Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.726e-22
Identity = 74/247 (29.96%), Postives = 117/247 (47.37%), Query Frame = 3
Query:   21 LKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTT-IPKEATEFTMEDFSTIMTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIRVNAXAPWIIRTSLIDSIEKDPRVMEHASXXXXXXXXXXXXETNEVSSGVAFPMFAAASYVTGQVFCIDG 758
            L    ALVT  T GIG AI   L   GA V   SR +  ++  +   K +GL V+G+ C +    +R++L+ T   +  G ++IL++NA  +       +   E +  I+  N ++   L++   P +   G G+I+ +SS+      P    Y  +K A+  LTKNLA E  + N+RVN  AP +IRTS    + +DP   E               +  E +  V+F     ASY+TG+   + G
Sbjct:   12 LDNKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDRAVATLKGEGLSVTGTVCHVGKAEDRERLVATAV-KLHGGVDILISNAAVSPFFGSLMDVPEEVWDKILDVNVKATALLTKAVVPEMAKRGGGSIVIVSSIAAYSPFPSLGPYNVSKTALLGLTKNLALELAESNVRVNCLAPGLIRTSFSRVLWEDPARQESIK---ATFQIKRIGKPEECAGIVSFLCSEDASYITGETVVVAG 254          
The following BLAST results are available for this feature:
BLAST of EY756102 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 264
Match NameE-valueIdentityDescription
TRNH_DATST1.028e-8359.77Tropinone reductase homolog OS=Datura stramonium P... [more]
TRN1_DATST2.007e-7957.81Tropinone reductase 1 OS=Datura stramonium GN=TR1 ... [more]
TRN2_DATST3.542e-7656.63Tropinone reductase 2 OS=Datura stramonium GN=TR2 ... [more]
TRNH1_ARATH2.296e-7555.47Tropinone reductase homolog At1g07440 OS=Arabidops... [more]
TRN2_HYONI3.315e-7453.73Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 P... [more]
GNO_GLUOX4.390e-2630.40Gluconate 5-dehydrogenase OS=Gluconobacter oxydans... [more]
FABG_BACSU1.196e-2331.983-oxoacyl-[acyl-carrier-protein] reductase OS=Baci... [more]
HDHA_ECOLI5.934e-2330.927-alpha-hydroxysteroid dehydrogenase OS=Escherichi... [more]
HDHA_ECO575.934e-2330.927-alpha-hydroxysteroid dehydrogenase OS=Escherichi... [more]
DHRS4_BOVIN1.726e-2229.96Dehydrogenase/reductase SDR family member 4 OS=Bos... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-F04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756102 ID=EY756102|Name=EY756102|organism=Citrus sinensis|type=EST|length=851bp
CCACGCGTCCGAGGTGGTCTCTAAAGGGTATGACCGCGCTTGTAACAGGT
GGAACCAGAGGCATCGGACACGCAATAGTGGAAGAACTAACGGCATTTGG
AGCAATAGTGCATACATGTTCACGTAATGAAACAGAGCTCAATGAAAGAA
TTCAAGAATGGAAGAGTAAGGGGCTTAAAGTAAGCGGCTCGGCATGTGAC
CTGAAAATTAGAGCTGAGCGTCAAAAGTTGATGGAGACTGTATGTTCTGA
ATTTGATGGCAAGCTCAACATCCTTGTAAACAATGCTGGAACCACCATTC
CTAAGGAAGCCACAGAATTTACCATGGAGGATTTCTCGACTATAATGACC
ACCAATTTCGAGTCTGCTTACCACCTGTCCCAACTTGCATACCCCCTACT
CAAAGCATCAGGAAATGGAAACATCATTTTTATCTCCTCTGTCACGGGTG
TTATAGCTGTACCTCTATGTTCCATCTATGCATCAACTAAAGGAGCAATG
AATCAACTGACAAAGAACTTGGCATGTGAGTGGGGAAAGGACAACATTCG
CGTGAATGCAGNTGCTCCATGGATCATTAGAACCTCTCTCATTGATTCCA
TAGAAAAGGATCCAAGGGTCATGGAACACGCTAGTCGTTTGATACCCCGT
ACTCCTATACCTCGTCCCAGAGAAACTAATGAGGTTTCGTCAGGGGTAGC
ATTCCCTATGTTTGCAGCCGCTTCATACGTCACCGGACAGGTTTTTTGTA
TTGATGGAAGATACTTCGGTGATGGATTTTANCCCTACGGACATGAAAAG
ATCCTTTAAATTTNCTGGCTGTCCCTCAAAGGCAGTTTAGGGCTTCATGG
T
back to top