EY756096

Overview
NameEY756096
Unique NameEY756096
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length534
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11577 contig Csv1_Contig11577:54..591. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756096 vs. ExPASy Swiss-Prot
Match: GRIMP_ARATH (Geminivirus Rep-interacting motor protein OS=Arabidopsis thaliana GN=GRIMP PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.445e-18
Identity = 48/60 (80.00%), Postives = 53/60 (88.33%), Query Frame = 1
Query:   37 SVLENFTTFWLKQVFSQLPEALSLLALARTADGTRARYSRLYRTLAMKVPSLRDLVGELE 216
            SVL N +   +KQ+F QLPEALSLLALARTADGTRARYSRLY+TLAMKVPSL+DLV ELE
Sbjct: 1214 SVLVNMSLEEMKQMFVQLPEALSLLALARTADGTRARYSRLYKTLAMKVPSLKDLVSELE 1273          
The following BLAST results are available for this feature:
BLAST of EY756096 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
GRIMP_ARATH2.445e-1880.00Geminivirus Rep-interacting motor protein OS=Arabi... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-E08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756096 ID=EY756096|Name=EY756096|organism=Citrus sinensis|type=EST|length=534bp
CCACGCGTCCGAATTATCCGGCTTGTACCAAGACCATCTGTTCTGGAAAA
TTTCACCACCTTTTGGCTGAAACAAGTATTCTCCCAGCTTCCCGAGGCAC
TTAGCTTGCTTGCACTTGCAAGAACGGCAGACGGAACCCGCGCACGATAT
TCTAGACTGTACAGGACTTTGGCCATGAAAGTTCCATCATTGAGAGACTT
AGTTGGTGAGCTTGAAAAGGGTGGAGTACTAAAAGATGTGAAGTCGTGAA
AATGGATGGTGTAGAGAGAATGTCGTTTGCCTTTGATGGATATTGTTTGC
TCATCTGTGTTTGTATTTGCGCGGACGGTTCCATTGCAATTGGTGCGGCA
AAATGTAATGGATTTTGCTTTGCTTCTGGAAAAGGAAGCTCTGCACACCA
AACTTGTAATGTAATCTATTGTGCATTGTATTTACACGCAATGATCATTG
CTGACACTAATAGCAATTTTGTGCAACACATCGATCATTAATATATTATT
TAATTGTTTGCTGGAAAAAAAAAAAAAAAAAAAA
back to top