EY756094

Overview
NameEY756094
Unique NameEY756094
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length789
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7063 contig Csv1_Contig7063:16..806. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTU6_ORYSJ (Probable glutathione S-transferase GSTU6 OS=Oryza sativa subsp. japonica GN=GSTU6 PE=2 SV=2)

HSP 1 Score: 197.208 bits (500), Expect = 2.471e-55
Identity = 92/167 (55.09%), Postives = 122/167 (73.05%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAW---SSSGPSILPSDPYDRAVARFWAAYVDEKLFPA-LKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGW 554
            +LG W SP+ +R R+ L +KS+ YE++EENLG KS+LLL SNPVHK +PVL+H  +PV ES +IV+Y+DE W   +   PS++PSDPY+RAVARFWAAYVD+K+ PA L  +  +   E + AA+ Q +  L  LE AF +CSKGKPFFGG  +GF+D+  G YLGW
Sbjct:    9 LLGVWSSPYAIRVRVVLNLKSLPYEYVEENLGDKSDLLLASNPVHKSVPVLLHAGRPVNESQVIVQYIDEVWPGGAGGRPSVMPSDPYERAVARFWAAYVDDKVRPAWLAILFGSKTEEERAAAVAQAVAALETLEGAFGECSKGKPFFGGDGVGFVDVVLGGYLGW 175          

HSP 2 Score: 40.4318 bits (93), Expect = 2.471e-55
Identity = 24/61 (39.34%), Postives = 35/61 (57.38%), Query Frame = 2
Query:  545 LGMGESDREMIEVKLLDEVKTPGLFQWAERFCADAACQDVMP-ETDKLAEFAKVLGKLRAS 724
            LG   +  ++I  +L+D  +TP L  W ERF A  A + V+P + DKL EF + L +  AS
Sbjct:  173 LGWFTAIDKLIGRRLIDPARTPALAAWEERFRATDAAKGVVPDDADKLLEFRQTLLRWSAS 233          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTX4_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.768e-44
Identity = 87/163 (53.37%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGW 554
            +L  WPS F MR RIAL  K ++YE+ EE+L +KS LLL+ NP+HKKIPVLIHN KP+CES+I VEY++E W    P++LPSDPYDRA ARFWA Y+D+KL+   + + +  G E +EAA +  IE L +LE A       KP+FGG   GF+DIA   Y  W
Sbjct:    8 LLDFWPSMFGMRLRIALAEKEIKYEYKEEDLRNKSPLLLQMNPIHKKIPVLIHNGKPICESIIAVEYIEEVWKDKAPNLLPSDPYDRAQARFWADYIDKKLYDFGRKLWTTKG-EEQEAAKKDFIECLKVLEGAL----GDKPYFGGESFGFVDIALIGYYSW 165          

HSP 2 Score: 26.1794 bits (56), Expect = 2.768e-44
Identity = 12/37 (32.43%), Postives = 18/37 (48.65%), Query Frame = 2
Query:  596 EVKTPGLFQWAERFCADAACQDVMPETDKLAEFAKVL 706
            E + P    WA+R     +    +P+  K+ EF KVL
Sbjct:  178 EAECPKFVAWAKRCMQRESVAKSLPDQPKVLEFVKVL 214          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTXC_TOBAC (Probable glutathione S-transferase parC OS=Nicotiana tabacum GN=PARC PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 1.766e-43
Identity = 85/163 (52.15%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGW 554
            +L  WPS F MR RIAL  K ++YE+ +E+L +KS LLL+ NP+HKKIPVLIHN KP+CES+I VEY++E W    PS+LPSDPYDRA ARFWA Y+D+KL+   + + +  G E +EAA +  IE L +LE A       +P+FGG   GF+DIA   +  W
Sbjct:    8 LLDFWPSMFGMRLRIALAEKEIKYEYKQEDLRNKSPLLLQMNPIHKKIPVLIHNGKPICESIIAVEYIEEVWKDKAPSLLPSDPYDRAQARFWADYIDKKLYDFGRKLWATKG-EEQEAAKKDFIECLKVLEGAL----GDRPYFGGESFGFVDIALIGFYSW 165          

HSP 2 Score: 26.1794 bits (56), Expect = 1.766e-43
Identity = 12/37 (32.43%), Postives = 18/37 (48.65%), Query Frame = 2
Query:  596 EVKTPGLFQWAERFCADAACQDVMPETDKLAEFAKVL 706
            E + P    WA+R     +    +P+  K+ EF KVL
Sbjct:  178 EAECPKFVAWAKRCMQRESVAKSLPDQPKVLEFVKVL 214          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTX6_SOYBN (Probable glutathione S-transferase OS=Glycine max GN=HSP26-A PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.648e-43
Identity = 86/167 (51.50%), Postives = 118/167 (70.66%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPAL-KSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGWVRV 563
            +LG   SPFV R +IALK+K VEY+FLEENLG+KS+LLLK NPVHKK+PV +HN++P+ ESL+IVEY+DE W ++   ILPSDPY RA+ARFW+ ++D+K+  A+ KS+ + D  E +E  +E+  E L  LE+      K K FFGG + G +DIA      W+ +
Sbjct:   10 LLGIVGSPFVCRVQIALKLKGVEYKFLEENLGNKSDLLLKYNPVHKKVPVFVHNEQPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKIVGAVSKSVFTVDEKE-REKNVEETYEALQFLENEL----KDKKFFGGEEFGLVDIAAVFIAFWIPI 169          

HSP 2 Score: 26.9498 bits (58), Expect = 8.648e-43
Identity = 12/45 (26.67%), Postives = 23/45 (51.11%), Query Frame = 2
Query:  566 REMIEVKLLDEVKTPGLFQWAERFCADAACQDVMPETDKLAEFAK 700
            +E+  ++L    K P L++W++ F       +V+P  D L  + K
Sbjct:  171 QEIAGLQLFTSEKFPILYKWSQEFLNHPFVHEVLPPRDPLFAYFK 215          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTXA_TOBAC (Probable glutathione S-transferase parA OS=Nicotiana tabacum GN=PARA PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.384e-38
Identity = 81/163 (49.69%), Postives = 107/163 (65.64%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGW 554
            +L  WPS F MR RIAL +K ++YE  EENL  KS LLL+ NPVHKKIP+LIHN K +CESL I+EY+DE W    P +LPSDPY+R+ ARFWA Y+D+K++   + + S  G E +E A ++ IE L  LE         K +FGG  +GF+D+A   +  W
Sbjct:    8 LLDFWPSSFGMRLRIALALKGIKYEAKEENLSDKSPLLLEMNPVHKKIPILIHNSKAICESLNILEYIDEVWHDKCP-LLPSDPYERSQARFWADYIDKKIYSTGRRVWSGKG-EDQEEAKKEFIEILKTLEGEL----GNKTYFGGDNLGFVDVALVPFTSW 164          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTX2_MAIZE (Probable glutathione S-transferase BZ2 OS=Zea mays GN=BZ2 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 5.800e-38
Identity = 79/177 (44.63%), Postives = 110/177 (62.15%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLG-SKSELLLKSNPVHKKIPVLIHND-KPVCESLIIVEYVDEAWSSSGPS-----ILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQI--GFLDIAFGCYLGWVRVTE 569
            VLG   SPF  RAR+AL ++ V YE L+E LG  KS+ LL +NPV+ KIPVL+  D + +CES +IV+Y+++    SG +     +LP DPY+RA+ RFW A++D+K +PAL ++  A    A+  A E     L LLE+AF   S G+ FF G     G LD+A GC+L  +R  E
Sbjct:    3 VLGGEVSPFTARARLALDLRGVAYELLDEPLGPKKSDRLLAANPVYGKIPVLLLPDGRAICESAVIVQYIEDVARESGGAEAGSLLLPDDPYERAMHRFWTAFIDDKFWPALDAVSLAPTPGARAQAAEDTRAALSLLEEAFKDRSNGRAFFSGGDAAPGLLDLALGCFLPALRACE 179          

HSP 2 Score: 38.1206 bits (87), Expect = 5.800e-38
Identity = 16/42 (38.10%), Postives = 27/42 (64.29%), Query Frame = 2
Query:  581 VKLLDEVKTPGLFQWAERFCADAACQDVMPETDKLAEFAKVL 706
            + L+D   TP L  W++RF A  A + V+P+T+K+ +F + L
Sbjct:  184 LSLIDASATPLLDGWSQRFAAHPAAKRVLPDTEKVVQFTRFL 225          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTX2_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.422e-36
Identity = 82/168 (48.81%), Postives = 111/168 (66.07%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGWVRVTE 569
            +LG W SPF  R   ALKIK V+YE++EE+  +KS LLL+SNPV+KK+PVLIHN KP+ ES+II+EY+DE +   GPSILP DPYDRA+ARFWA ++D+K+   + +       E +E   E++ E L +L++      K K FF G + GF DIA      W+ V E
Sbjct:    6 LLGFWYSPFSHRVEWALKIKGVKYEYIEEDRDNKSSLLLQSNPVYKKVPVLIHNGKPIVESMIILEYIDETF--EGPSILPKDPYDRALARFWAKFLDDKVAAVVNTFFRK--GEEQEKGKEEVYEMLKVLDNEL----KDKKFFAGDKFGFADIAANLVGFWLGVFE 165          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTX1_SOLTU (Probable glutathione S-transferase OS=Solanum tuberosum GN=PRP1 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.857e-36
Identity = 85/155 (54.84%), Postives = 107/155 (69.03%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDI 530
            +LG   SPF  R   ALKIK V+YEF+EE+L +KS LLL+SNP+HKKIPVLIHN K +CES++I+EY+DEA+   GPSILP DPYDRA+ARFWA YV++K     KS  S    E +E A E+  E L +L++ F    K K  F G + GF DI
Sbjct:    6 LLGLRYSPFSHRVEWALKIKGVKYEFIEEDLQNKSPLLLQSNPIHKKIPVLIHNGKCICESMVILEYIDEAF--EGPSILPKDPYDRALARFWAKYVEDKGAAVWKSFFSK--GEEQEKAKEEAYEMLKILDNEF----KDKKCFVGDKFGFADI 152          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTX3_SOYBN (Glutathione S-transferase 3 OS=Glycine max GN=GST3 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.425e-36
Identity = 76/163 (46.63%), Postives = 104/163 (63.80%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGW 554
            +L  W S + MRARIAL  K V YE+ EENL ++S LLL+ NP+HKKIPVLIHN KP+CES IIV+Y+DE W+   P ++PSDPY R+ ARFW  Y+D+K++   K +  + G E +E   ++LI     LE+        KPF+G    GF+D+    +  W
Sbjct:    7 LLDTWASMYGMRARIALAEKGVRYEYKEENLMNRSPLLLQMNPIHKKIPVLIHNGKPICESAIIVQYIDEVWNDKSP-LMPSDPYKRSQARFWVDYIDKKIYDTWKKMWLSKGEEHEEGK-KELISIFKQLEETLT----DKPFYGDDTFGFVDLCLITFSSW 163          
BLAST of EY756094 vs. ExPASy Swiss-Prot
Match: GSTX1_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.167e-36
Identity = 81/168 (48.21%), Postives = 111/168 (66.07%), Query Frame = 3
Query:   66 VLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSADGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFGCYLGWVRVTE 569
            +LG W SPF  R   ALKIK V+YE++EE+  +KS LLL+SNP+HKK+PVLIHN K + ES++I+EY+DE +   GPSILP DPYDRA+ARFWA ++D+K+   +K+       E +E   E++ E L +L++      K K FF G + GF DIA      W+ V E
Sbjct:    6 LLGFWYSPFSRRVEWALKIKGVKYEYIEEDRDNKSSLLLQSNPIHKKVPVLIHNGKRIVESMVILEYIDETF--EGPSILPKDPYDRALARFWAKFLDDKVPAVVKTF--LRKGEEQEKDKEEVCEMLKVLDNEL----KDKKFFVGDKFGFADIAANLVAFWLGVFE 165          
The following BLAST results are available for this feature:
BLAST of EY756094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
GSTU6_ORYSJ2.471e-5555.09Probable glutathione S-transferase GSTU6 OS=Oryza ... [more]
GSTX4_TOBAC2.768e-4453.37Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTXC_TOBAC1.766e-4352.15Probable glutathione S-transferase parC OS=Nicotia... [more]
GSTX6_SOYBN8.648e-4351.50Probable glutathione S-transferase OS=Glycine max ... [more]
GSTXA_TOBAC3.384e-3849.69Probable glutathione S-transferase parA OS=Nicotia... [more]
GSTX2_MAIZE5.800e-3844.63Probable glutathione S-transferase BZ2 OS=Zea mays... [more]
GSTX2_TOBAC1.422e-3648.81Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTX1_SOLTU1.857e-3654.84Probable glutathione S-transferase OS=Solanum tube... [more]
GSTX3_SOYBN2.425e-3646.63Glutathione S-transferase 3 OS=Glycine max GN=GST3... [more]
GSTX1_TOBAC3.167e-3648.21Probable glutathione S-transferase OS=Nicotiana ta... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-E06-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756094 ID=EY756094|Name=EY756094|organism=Citrus sinensis|type=EST|length=789bp
CCACGCGTCCGAGAGCAGAGCTTAGAGAAAAAAAAAAAAAGAAAATGGCA
AAAAGCGACGTGAAGGTTTTGGGTGCGTGGCCAAGCCCATTTGTGATGAG
GGCAAGAATCGCACTTAAGATCAAGTCTGTGGAGTATGAGTTTCTGGAGG
AGAATTTGGGATCCAAAAGCGAGCTTCTGCTTAAATCAAACCCTGTTCAC
AAGAAAATCCCAGTTCTGATTCACAATGATAAGCCTGTTTGCGAATCTCT
CATCATTGTCGAGTACGTGGATGAGGCTTGGTCCTCTTCAGGTCCCTCTA
TTCTTCCTTCTGATCCTTATGACCGTGCCGTTGCTCGTTTCTGGGCCGCT
TATGTTGATGAGAAGTTGTTCCCTGCCTTGAAAAGCATTGGTAGTGCAGA
TGGAGCGGAAGCTAAGGAAGCTGCGATTGAGCAATTGATTGAAGGCTTGG
TTTTGCTGGAGGATGCTTTTGTTAAGTGTAGCAAAGGGAAGCCTTTCTTT
GGTGGAAGCCAAATTGGGTTTCTTGACATTGCATTTGGTTGCTACTTGGG
ATGGGTGAGAGTGACAGAGAAATGATTGAGGTGAAGCTCCTTGATGAAGT
CAAAACTCCTGGACTGTTTCAATGGGCTGAGAGATTCTGTGCTGATGCCG
CCTGTCAAGATGTTATGCCTGAAACTGATAAGCTTGCAGAGTTTGCTAAG
GTTCTTGGCAAACTCAGAGCTTCTGGCAAATGAATTAAGAAACTTTAATC
TGTGCTTGGAGGGGCACAAAAAAAGGAAAAAAAAAAAAA
back to top