EY756092

Overview
NameEY756092
Unique NameEY756092
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY756092_ssr38 microsatellite EY756092_ssr38:38..57. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL15_PETHY (60S ribosomal protein L15 OS=Petunia hybrida GN=RPL15 PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.576e-77
Identity = 144/183 (78.69%), Postives = 156/183 (85.25%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGLPAI*HLHSR 614
            +GAYT+VSELWRKKQS+VM FLQRVRCWEYRQ PSIVRVTRPT PD ARRL Y AK GYVVYRVR+ R GRKRPVP+GIVYGKPTN  VTQLKFQR+KRSVA+ERAGRKLGG  VLNSYWINEDSTYKYFEVIL D AH A+ +DPRINW+C  VHKHR LRGL SA K YRGL    HLH++
Sbjct:    1 MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRTKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHNK 183          
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL152_ARATH (60S ribosomal protein L15-2 OS=Arabidopsis thaliana GN=RPL15B PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 8.093e-74
Identity = 135/174 (77.59%), Postives = 149/174 (85.63%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGL 587
            +GAY +VSELWRKKQS+VM FLQRVRCWEYRQ PSIVR+ RPT PD ARRL Y AK G+VVYRVR+ R GRKRPVP+GIVYGKPTN  VTQLKFQRSKRSVA+ERAGRKLGG  V+NSYW+NEDSTYKY+E+IL DPAHNAV +DPRINW+C  VHKHR LRGL S  K  RGL
Sbjct:    1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGL 174          
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL151_ARATH (60S ribosomal protein L15-1 OS=Arabidopsis thaliana GN=RPL15A PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 8.093e-74
Identity = 135/174 (77.59%), Postives = 149/174 (85.63%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGL 587
            +GAY +VSELWRKKQS+VM FLQRVRCWEYRQ PSIVR+ RPT PD ARRL Y AK G+VVYRVR+ R GRKRPVP+GIVYGKPTN  VTQLKFQRSKRSVA+ERAGRKLGG  V+NSYW+NEDSTYKY+E+IL DPAHNAV +DPRINW+C  VHKHR LRGL S  K  RGL
Sbjct:    1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGL 174          
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL15A_PICMA (60S ribosomal protein L15-1 OS=Picea mariana GN=SB61 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 3.400e-72
Identity = 132/183 (72.13%), Postives = 151/183 (82.51%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGLPAI*HLHSR 614
            +GAY ++ ELW+KKQS+VM FLQRVRCWE+RQ P IVRVTRP+ PD ARRL Y AK GYVVYRVR+ R GRKRPVP+GIVYGKP N  +TQLKFQRS RSVA+ERAGRKLGG  VLNSYWIN+DSTYKY+E+IL D AH+A+  DPRINW+C AVHKHR LRGL SA K YRGL    HL+ +
Sbjct:    1 MGAYKYIEELWKKKQSDVMRFLQRVRCWEFRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYYEIILVDQAHSAIRKDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHLYHK 183          
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL15B_PICMA (60S ribosomal protein L15-2 OS=Picea mariana GN=SB62 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 4.441e-72
Identity = 131/183 (71.58%), Postives = 149/183 (81.42%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGLPAI*HLHSR 614
            +GAY ++ ELW+KKQS+VM FLQRVRCWEYRQ P IVR+T PT PD ARRL Y AK GYVVYRVR+ R GRKRPVP+GIVYGKP N  +TQLKFQRS RSVA+ERAGRKLGG  VLNSYWIN+DSTYKY+EV+L D AH  + +DPRINW+C AVHKHR LRGL SA K YRGL    HL+ +
Sbjct:    1 MGAYKYIEELWKKKQSDVMRFLQRVRCWEYRQLPGIVRITHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHLYHK 183          
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL15_HYPNO (60S ribosomal protein L15 OS=Hypophthalmichthys nobilis GN=rpl15 PE=2 SV=3)

HSP 1 Score: 228.409 bits (581), Expect = 4.311e-59
Identity = 113/185 (61.08%), Postives = 133/185 (71.89%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGLPAI*HLHSRLG 620
            +GAY ++ ELWRKKQSNVM FL RVRCW+YRQ  S+ R  RPT PD ARRL Y AK GYV+YR+R+ R GRKRPVP+G  YGKP +H V Q+KF RS +SVA+ERAGR  GG  VLNSYW+ EDSTYK+FEVIL D  H A+  +P   W+  AVHKHR +RGL SA K  RGL      H  +G
Sbjct:    1 MGAYKYMQELWRKKQSNVMRFLLRVRCWQYRQLSSLHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGGLRVLNSYWVGEDSTYKFFEVILIDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGLGKGHKFHLTIG 185          
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL15_MEGAM (60S ribosomal protein L15 OS=Megalobrama amblycephala GN=rpl15 PE=2 SV=3)

HSP 1 Score: 226.868 bits (577), Expect = 1.254e-58
Identity = 112/185 (60.54%), Postives = 133/185 (71.89%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGLPAI*HLHSRLG 620
            +GAY ++ +LWRKKQSNVM FL RVRCW+YRQ  S+ R  RPT PD ARRL Y AK GYV+YR+R+ R GRKRPVP+G  YGKP +H V Q+KF RS +SVA+ERAGR  GG  VLNSYW+ EDSTYK+FEVIL D  H A+  +P   W+  AVHKHR +RGL SA K  RGL      H  +G
Sbjct:    1 MGAYKYMQKLWRKKQSNVMRFLLRVRCWQYRQLSSLHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGGLRVLNSYWVGEDSTYKFFEVILIDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGLGKGHKFHLTIG 185          
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL15_MYLPI (60S ribosomal protein L15 OS=Mylopharyngodon piceus GN=rpl15 PE=2 SV=3)

HSP 1 Score: 226.483 bits (576), Expect = 1.638e-58
Identity = 112/185 (60.54%), Postives = 133/185 (71.89%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGLPAI*HLHSRLG 620
            +GAY ++ ELWRKKQS+VM FL RVRCW+YRQ  S+ R  RPT PD ARRL Y AK GYV+YR+R+ R GRKRPVP+G  YGKP +H V Q+KF RS +SVA+ERAGR  GG  VLNSYW+ EDSTYK+FEVIL D  H A+  +P   W+  AVHKHR +RGL SA K  RGL      H  +G
Sbjct:    1 MGAYKYMQELWRKKQSDVMRFLLRVRCWQYRQLSSLHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGGLRVLNSYWVGEDSTYKFFEVILIDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGLGKGHKFHLTIG 185          
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL15_MONAL (60S ribosomal protein L15 OS=Monopterus albus GN=rpl15 PE=2 SV=3)

HSP 1 Score: 226.483 bits (576), Expect = 1.638e-58
Identity = 112/185 (60.54%), Postives = 133/185 (71.89%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGLPAI*HLHSRLG 620
            +GAY ++ ELWRKKQS+VM FL RVRCW+YRQ  ++ R  RPT PD ARRL Y AK GYV+YRVR+ R GRKRPVP+G  YGKP +H V Q+KF RS +SVA+ERAGR  G   VLNSYW+ EDSTYK+FEVIL DP H A+  +P   W+  AVHKHR +RGL SA K  RGL      H  +G
Sbjct:    1 MGAYRYMQELWRKKQSDVMRFLLRVRCWQYRQLSNLHRAPRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPVHHGVNQIKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGLGKGHKFHLTIG 185          
BLAST of EY756092 vs. ExPASy Swiss-Prot
Match: RL15_ICTPU (60S ribosomal protein L15 OS=Ictalurus punctatus GN=rpl15 PE=2 SV=3)

HSP 1 Score: 226.483 bits (576), Expect = 1.638e-58
Identity = 113/185 (61.08%), Postives = 133/185 (71.89%), Query Frame = 3
Query:   66 VGAYTFVSELWRKKQSNVMMFLQRVRCWEYRQHPSIVRVTRPTPPD*ARRLCYYAKLGYVVYRVRLWRVGRKRPVPRGIVYGKPTNHCVTQLKFQRSKRSVAQERAGRKLGGPTVLNSYWINEDSTYKYFEVILPDPAHNAVLHDPRINWLCYAVHKHRGLRGLYSACKNYRGLPAI*HLHSRLG 620
            +GAY ++ ELWRKKQS+VM FL RVRCW+YRQ  ++ R  RPT PD ARRL Y AK GYV+YRVR+ R GRKRPVP+G  YGKP +H V QLKF RS +SVA+ERAGR  GG  VLNSYW+ EDSTYK+FEVIL D  H A+  +P   W+  AVHKHR +RGL SA K  RGL      H  +G
Sbjct:    1 MGAYKYMQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGGLRVLNSYWVGEDSTYKFFEVILIDTFHKAIRRNPDTQWITKAVHKHREMRGLTSAGKKSRGLGKGHKFHLTIG 185          
The following BLAST results are available for this feature:
BLAST of EY756092 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 93
Match NameE-valueIdentityDescription
RL15_PETHY1.576e-7778.6960S ribosomal protein L15 OS=Petunia hybrida GN=RP... [more]
RL152_ARATH8.093e-7477.5960S ribosomal protein L15-2 OS=Arabidopsis thalian... [more]
RL151_ARATH8.093e-7477.5960S ribosomal protein L15-1 OS=Arabidopsis thalian... [more]
RL15A_PICMA3.400e-7272.1360S ribosomal protein L15-1 OS=Picea mariana GN=SB... [more]
RL15B_PICMA4.441e-7271.5860S ribosomal protein L15-2 OS=Picea mariana GN=SB... [more]
RL15_HYPNO4.311e-5961.0860S ribosomal protein L15 OS=Hypophthalmichthys no... [more]
RL15_MEGAM1.254e-5860.5460S ribosomal protein L15 OS=Megalobrama amblyceph... [more]
RL15_MYLPI1.638e-5860.5460S ribosomal protein L15 OS=Mylopharyngodon piceu... [more]
RL15_MONAL1.638e-5860.5460S ribosomal protein L15 OS=Monopterus albus GN=r... [more]
RL15_ICTPU1.638e-5861.0860S ribosomal protein L15 OS=Ictalurus punctatus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756092 ID=EY756092|Name=EY756092|organism=Citrus sinensis|type=EST|length=901bp
CCACGCGTCCGATAACCCTAGTCGCACGGATACTGCGCAGCTCAGCTCAG
CTCAGCTCAGAGGCAGTGGGGGCTTACACGTTCGTGTCGGAGCTATGGAG
GAAGAAACAGTCAAATGTGATGATGTTCTTGCAGAGGGTGAGGTGTTGGG
AGTACCGCCAACATCCATCTATTGTTAGGGTCACCCGTCCCACTCCACCT
GACTAGGCTCGACGCTTGTGTTACTATGCCAAGCTGGGTTATGTTGTTTA
TCGTGTGCGGCTATGGCGTGTTGGTCGGAAGAGGCCTGTTCCCAGGGGCA
TTGTGTATGGTAAACCCACAAACCATTGTGTTACTCAACTGAAGTTTCAA
CGCAGCAAGAGGTCTGTTGCACAGGAGCGTGCCGGTCGCAAGTTGGGAGG
TCCTACGGTTCTCAACTCTTACTGGATCAATGAGGACTCCACTTATAAGT
ACTTTGAGGTGATCTTGCCTGATCCTGCTCATAATGCCGTCCTACATGAC
CCCAGAATTAATTGGTTATGCTATGCTGTCCATAAGCACAGGGGACTCCG
TGGTCTTTACTCTGCATGTAAGAATTACAGAGGCCTACCTGCGATATGAC
ACTTGCACTCTAGGCTCGGACTTCACAAGGTCTAACTGTAATAGAACAAT
ACTTCTTTCCCTCAGGCGATACCGCCGATCACTGCTTTGGGTTGATGATT
TATCCTCNGNAGAGGGATTTGCCTGGATGACATAAAAATTTCACTCTGAC
ACTTTGGGGATTTTATTCAGGGGAGGTGTCGGATCCCCAAACTGTATTTT
TATAAAAACTTCGAGGTTCTCGGGCTCCCGGAATATCCAGCCTTAGTTCC
CAAACTGGTAAGGGCTGTGAGGATTTTTTCCTCCCGGGGGCACTTTCCCT
T
back to top