EY756004

Overview
NameEY756004
Unique NameEY756004
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length702
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5151 contig Csv1_Contig5151:1743..2444. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756004 vs. ExPASy Swiss-Prot
Match: SERA_ARATH (D-3-phosphoglycerate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=At1g17745 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.434e-26
Identity = 60/75 (80.00%), Postives = 64/75 (85.33%), Query Frame = 2
Query:   11 GNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKVPAIEEFVFLKL 235
            GNLILCRQVDQPGMIG+VGNILGE NVNVNFMSVGRT  R   IMAIGVDEEP+  +L+ IG V AIEEFVFLKL
Sbjct:  550 GNLILCRQVDQPGMIGQVGNILGEQNVNVNFMSVGRTVLRKQAIMAIGVDEEPDNKTLERIGGVSAIEEFVFLKL 624          
The following BLAST results are available for this feature:
BLAST of EY756004 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SERA_ARATH1.434e-2680.00D-3-phosphoglycerate dehydrogenase, chloroplastic ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-E05-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756004 ID=EY756004|Name=EY756004|organism=Citrus sinensis|type=EST|length=702bp
CCACGCGTCCGGGAACCTCATCCTGTGCCGGCAGGTTGATCAGCCTGGCA
TGATTGGCAAGGTTGGGAACATACTTGGTGAGCATAATGTCAATGTGAAC
TTCATGAGTGTAGGAAGAACTTTCAGGAGGAATCATGGGATCATGGCAAT
CGGCGTTGATGAAGAACCAAATCAGGATTCCCTCAAGGAAATAGGAAAGG
TGCCTGCAATTGAAGAGTTTGTATTCCTCAAACTATGATTCATGAAAGAG
TTTGAAATAATATGGTTTCTGAATCGAGTAACCGGTGATGGATTTCGATT
AGGTACACTTTGTTGCACGTATCTTATAGCGTGCGACTACGTGCATGGCG
ATTTATAATTGGTGGAGCCACATCGTGGGGACCACAATCCTGCTAATGAA
CACTCGCCACGTGTGCAGTCGCGCATTAGATTGGAACTCAACTATAGTGA
TAGTCTTTTTTATTGTCAAGTGTTAGTTACCGTCCTTAATTGATGGTGTA
GAAATTGCTTAAACTTTATTTAAGCTGGTAGCACCTGATTAAGTGCTTCT
ATTGGTGTTTGTATGAGCCTTTCATAAATCGTAATTCTAGCCAGTATTTG
TATAAGCTTGCTTCCATAGAGCAGAGGGAAAGCTTTNCATTTGTAAATTT
CAGTATTCAATGGAAGCTTATCTCAAAATTGCTAAGTAAAAAAAAAAAAA
AA
back to top