EY755994

Overview
NameEY755994
Unique NameEY755994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length868
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 5.765e-114
Identity = 201/211 (95.26%), Postives = 203/211 (96.21%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVE+LLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAI RNCL+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  130 PMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVESLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 340          

HSP 2 Score: 30.8018 bits (68), Expect = 5.765e-114
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  338 LGNNDGMNLSAPQTFRSKEISKS 360          

HSP 3 Score: 26.5646 bits (57), Expect = 5.765e-114
Identity = 11/11 (100.00%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKSILPM
Sbjct:  121 IYAPFKSILPM 131          
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 8.746e-109
Identity = 188/211 (89.10%), Postives = 200/211 (94.79%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NPDD+VFGGWDISDMNLADAMARA+VFDIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTKKEQ+ QIIKDIREFKEKNKVD+VVVLWTANTERYSNV+VGLNDT+ENL AS+D+NEAEISPSTLYAIAC+LEN+PFINGSPQNTFVPGLIDLAI +N L+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  130 PMVNPDDVVFGGWDISDMNLADAMARAKVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQIDQIIKDIREFKEKNKVDKVVVLWTANTERYSNVVVGLNDTMENLFASVDRNEAEISPSTLYAIACILENVPFINGSPQNTFVPGLIDLAIKKNTLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 340          

HSP 2 Score: 30.8018 bits (68), Expect = 8.746e-109
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  338 LGNNDGMNLSAPQTFRSKEISKS 360          

HSP 3 Score: 25.7942 bits (55), Expect = 8.746e-109
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKS+LPM
Sbjct:  121 IYAPFKSLLPM 131          
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 2.525e-108
Identity = 188/211 (89.10%), Postives = 199/211 (94.31%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NPDD+VFGGWDIS MNLADAMARA+VFDIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTKKEQ+ QIIKDIREFKEKNKVD+VVVLWTANTERYSNV+VGLNDT+ENL AS+D+NEAEISPSTLYAIAC+LEN+PFINGSPQNTFVPGLIDLAI RN L+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  130 PMVNPDDVVFGGWDISGMNLADAMARAKVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQIDQIIKDIREFKEKNKVDKVVVLWTANTERYSNVVVGLNDTMENLFASVDRNEAEISPSTLYAIACILENVPFINGSPQNTFVPGLIDLAIKRNTLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 340          

HSP 2 Score: 30.8018 bits (68), Expect = 2.525e-108
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  338 LGNNDGMNLSAPQTFRSKEISKS 360          

HSP 3 Score: 25.7942 bits (55), Expect = 2.525e-108
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKS+LPM
Sbjct:  121 IYAPFKSLLPM 131          
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2)

HSP 1 Score: 377.096 bits (967), Expect = 1.614e-107
Identity = 188/211 (89.10%), Postives = 197/211 (93.36%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NPDD+VFGGWDIS+MNLADAM RA+V DIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTKKEQM QIIKDIREFKEK+KVD+VVVLWTANTERYSNV VGLNDT+ENLLAS+DKNEAEISPSTLYAIACV+E IPFINGSPQNTFVPGLIDLAI  NCL+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  130 PMVNPDDLVFGGWDISNMNLADAMTRAKVLDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQMEQIIKDIREFKEKSKVDKVVVLWTANTERYSNVCVGLNDTMENLLASVDKNEAEISPSTLYAIACVMEGIPFINGSPQNTFVPGLIDLAIKNNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 340          

HSP 2 Score: 30.8018 bits (68), Expect = 1.614e-107
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  338 LGNNDGMNLSAPQTFRSKEISKS 360          

HSP 3 Score: 25.7942 bits (55), Expect = 1.614e-107
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKS+LPM
Sbjct:  121 IYAPFKSLLPM 131          
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO1_HORVU (Inositol-3-phosphate synthase OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 2.286e-106
Identity = 185/211 (87.68%), Postives = 194/211 (91.94%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NPDD+VFGGWDIS MNLADAM RA+V DIDLQKQLRPYMESM PLPGIYD DFIAANQGSRANNVIKGTKKEQM Q+IKDIREFKEKNKVD+VVVLWTANTERYSNV VGLNDT ENLLAS+DKNEAEISPSTLYAIACV+E +PFINGSPQNTFVPGLIDLAI  +CL+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  130 PMVNPDDLVFGGWDISSMNLADAMTRAKVLDIDLQKQLRPYMESMCPLPGIYDPDFIAANQGSRANNVIKGTKKEQMEQVIKDIREFKEKNKVDKVVVLWTANTERYSNVSVGLNDTTENLLASVDKNEAEISPSTLYAIACVMEGVPFINGSPQNTFVPGLIDLAIKNDCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 340          

HSP 2 Score: 30.8018 bits (68), Expect = 2.286e-106
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  338 LGNNDGMNLSAPQTFRSKEISKS 360          

HSP 3 Score: 25.7942 bits (55), Expect = 2.286e-106
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKS+LPM
Sbjct:  121 IYAPFKSLLPM 131          
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 2.980e-106
Identity = 184/211 (87.20%), Postives = 199/211 (94.31%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NPDD+VFGGWDISDMNLADAMARARV DIDLQKQLRPYME MVPLPGIYD DFIAANQGSRAN+VIKGTKKEQ+ QIIKD+REFKEKNKVD++VVLWTANTERYS+V+VGLNDT+ENLLAS++KNE+EISPSTLYAIACVLE IPFINGSPQNTFVPGLI+LAI +NCL+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  130 PMVNPDDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANSVIKGTKKEQVDQIIKDMREFKEKNKVDKLVVLWTANTERYSDVVVGLNDTMENLLASVEKNESEISPSTLYAIACVLEGIPFINGSPQNTFVPGLIELAISKNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 340          

HSP 2 Score: 30.8018 bits (68), Expect = 2.980e-106
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  338 LGNNDGMNLSAPQTFRSKEISKS 360          

HSP 3 Score: 25.7942 bits (55), Expect = 2.980e-106
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKS+LPM
Sbjct:  121 IYAPFKSLLPM 131          
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO1_MAIZE (Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2)

HSP 1 Score: 372.474 bits (955), Expect = 3.884e-106
Identity = 183/211 (86.73%), Postives = 196/211 (92.89%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NPDDIVFGGWDIS+MNLAD+M RA+V DIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRAN+VIKGTKKEQ+ QIIKDIREFKEKNKVD++VVLWTANTERYSNV  GLNDT+ENLLAS+DKNEAE+SPSTLYAIACV+E +PFINGSPQNTFVPGLIDLAI  NCL+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  130 PMVNPDDIVFGGWDISNMNLADSMTRAKVLDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANSVIKGTKKEQVEQIIKDIREFKEKNKVDKIVVLWTANTERYSNVCAGLNDTMENLLASVDKNEAEVSPSTLYAIACVMEGVPFINGSPQNTFVPGLIDLAIKNNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 340          

HSP 2 Score: 30.8018 bits (68), Expect = 3.884e-106
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  338 LGNNDGMNLSAPQAFRSKEISKS 360          

HSP 3 Score: 25.7942 bits (55), Expect = 3.884e-106
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKS+LPM
Sbjct:  121 IYAPFKSLLPM 131          
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 6.598e-106
Identity = 183/211 (86.73%), Postives = 196/211 (92.89%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NPDD+VFGGWDISDMNLADAM RARVFDIDLQKQLRPYME MVPLPGIYD DFIAANQGSRANNVIKGTKKEQ+ ++IKDIREFKEKNKVD+VVVLWT NTERYSNV+VGLNDT+ENLLASL+KNE+EISPST YA+AC+ ENIPFINGSPQNTFVPGLIDLAI +N L+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  132 PMVNPDDVVFGGWDISDMNLADAMTRARVFDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQVERVIKDIREFKEKNKVDKVVVLWTGNTERYSNVVVGLNDTMENLLASLEKNESEISPSTSYALACIEENIPFINGSPQNTFVPGLIDLAIKKNSLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 342          

HSP 2 Score: 30.8018 bits (68), Expect = 6.598e-106
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  340 LGNNDGMNLSAPQTFRSKEISKS 362          

HSP 3 Score: 25.7942 bits (55), Expect = 6.598e-106
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKS+LPM
Sbjct:  123 IYAPFKSLLPM 133          
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 8.601e-106
Identity = 181/211 (85.78%), Postives = 199/211 (94.31%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NP++IVFGGWDISDMNLADAMARA+V DIDLQKQ+RP+ME MVPLPGI+D DFIAANQGSRAN+VIKGTKK+Q+ Q+IKDIREFKEKNKVD+VVVLWTANTERYSNV+VGLNDT ENL++SLDK+EAEISPSTLYAIACVLEN+PFINGSPQNTFVPGLI+LAI RNCL+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  130 PMVNPEEIVFGGWDISDMNLADAMARAKVLDIDLQKQMRPFMEHMVPLPGIFDPDFIAANQGSRANHVIKGTKKQQLEQVIKDIREFKEKNKVDKVVVLWTANTERYSNVVVGLNDTTENLMSSLDKDEAEISPSTLYAIACVLENVPFINGSPQNTFVPGLIELAIKRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 340          

HSP 2 Score: 30.8018 bits (68), Expect = 8.601e-106
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  338 LGNNDGMNLSAPQTFRSKEISKS 360          

HSP 3 Score: 25.7942 bits (55), Expect = 8.601e-106
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKS+LPM
Sbjct:  121 IYAPFKSLLPM 131          
BLAST of EY755994 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 369.777 bits (948), Expect = 2.483e-105
Identity = 182/211 (86.26%), Postives = 198/211 (93.84%), Query Frame = 2
Query:   38 PYGNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQIIKDIREFKEKNKVDRVVVLWTANTERYSNVIVGLNDTVENLLASLDKNEAEISPSTLYAIACVLENIPFINGSPQNTFVPGLIDLAIXRNCLMGGDDFKSGQTKMKSVLGDFLGGAGIKPTSIGSYNHWGN 670
            P  NP+D+VFGGWDISDMNLADAMARARV DIDLQKQLRPYME+M+PLPGIYD DFIAANQGSRAN+VIKGTKKEQ+  IIKD+REFKEKNKVD++VVLWTANTERYSNVIVGLNDT ENLLAS++K+E+EISPSTLYAIACVLE IPFINGSPQNTFVPGLI+LAI +NCL+GGDDFKSGQTKMKSVL DFL GAGIKPTSI SYNH GN
Sbjct:  130 PMVNPEDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMENMIPLPGIYDPDFIAANQGSRANSVIKGTKKEQVDHIIKDMREFKEKNKVDKLVVLWTANTERYSNVIVGLNDTTENLLASVEKDESEISPSTLYAIACVLEGIPFINGSPQNTFVPGLIELAISKNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGN 340          

HSP 2 Score: 30.8018 bits (68), Expect = 2.483e-105
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  661 LGKHDGMNLSAPKPSRSRRFQKN 729
            LG +DGMNLSAP+  RS+   K+
Sbjct:  338 LGNNDGMNLSAPQTFRSKEISKS 360          

HSP 3 Score: 25.7942 bits (55), Expect = 2.483e-105
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:   12 IYAPFKSILPM 44
            IYAPFKS+LPM
Sbjct:  121 IYAPFKSLLPM 131          
The following BLAST results are available for this feature:
BLAST of EY755994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_CITPA5.765e-11495.26Inositol-3-phosphate synthase OS=Citrus paradisi P... [more]
INO1_NICPA8.746e-10989.10Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_TOBAC2.525e-10889.10Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_ORYSJ1.614e-10789.10Inositol-3-phosphate synthase OS=Oryza sativa subs... [more]
INO1_HORVU2.286e-10687.68Inositol-3-phosphate synthase OS=Hordeum vulgare P... [more]
INO1_WHEAT2.980e-10687.20Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_MAIZE3.884e-10686.73Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=... [more]
INO1_MESCR6.598e-10686.73Inositol-3-phosphate synthase OS=Mesembryanthemum ... [more]
INO3_ARATH8.601e-10685.78Probable inositol-3-phosphate synthase isozyme 3 O... [more]
INO2_ARATH2.483e-10586.26Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-D05-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755994 ID=EY755994|Name=EY755994|organism=Citrus sinensis|type=EST|length=868bp
CCACGCGTCCGATTTATGCTCCATTCAAGAGCATTCTCCCTATGGGAACC
CAGATGACATTGTGTTTGGAGGATGGGACATTAGTGACATGAACTTGGCT
GATGCCATGGCCAGGGCTAGAGTGTTTGATATTGATCTTCAAAAGCAACT
TAGGCCTTACATGGAATCAATGGTCCCACTTCCTGGAATCTATGACCTTG
ATTTCATTGCTGCCAATCAAGGGTCCCGTGCCAACAACGTGATCAAAGGA
ACCAAGAAAGAACAAATGCTACAAATCATCAAAGATATTAGAGAGTTTAA
GGAGAAAAACAAGGTGGATAGGGTTGTTGTACTGTGGACTGCTAACACTG
AGAGGTACAGTAATGTGATTGTTGGGCTAAATGACACAGTGGAGAACCTT
CTTGCTTCACTGGACAAAAACGAAGCTGAGATTTCTCCTTCCACCTTGTA
TGCTATTGCTTGTGTTCTTGAAAATATCCCTTTCATCAATGGAAGCCCCC
AAAACACCTTTGTACCAGGGCTTATTGACTTGGCTATTANGAGGAACTGT
TTGATGGGTGGAGATGACTTCAAGAGTGGGCAGACTAAGATGAAATCTGT
TTTGGGTGATTTCCTTGGTGGGGCAGGAATCAAGCCCACATCAATTGGTA
GCTACAACCACTGGGGAAACATGATGGAATGAATCTTTCAGCCCCTAAAC
CTTCCCGTTCAAGGAGATTCCAAAAGAATGGTTGTGATGAATGGCCTCCG
ACATGGGATCCTTTAGGGCCTGGGGACCCCCGGACCCGTTGGGGCATCAA
GATGGGCCATTTGGTGGCATACAAAAAACCTGGATGATCCCCTCAAAATT
CCTGGGGGGAAGAACCCT
back to top