EY755985

Overview
NameEY755985
Unique NameEY755985
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length414
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY755985_ssr277 microsatellite EY755985_ssr277:277..288. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1817 contig Csv1_Contig1817:112..525. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755985 vs. ExPASy Swiss-Prot
Match: SNAK1_SOLTU (Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 8.485e-31
Identity = 54/72 (75.00%), Postives = 59/72 (81.94%), Query Frame = 1
Query:    1 PRVREPATAGSPFCDSKCAERCKQAGVQDRCLKYCGICCEDCKCVPSGTYGNKHECPCYRDKVNKKGKPKCP 216
            P + +   AGS FCDSKC  RC +AG+ DRCLKYCGICCE+CKCVPSGTYGNKHECPCYRDK N KGK KCP
Sbjct:   17 PSLIQTTMAGSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP 88          
BLAST of EY755985 vs. ExPASy Swiss-Prot
Match: GAST1_SOLLC (Protein GAST1 OS=Solanum lycopersicum GN=GAST1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.524e-15
Identity = 29/59 (49.15%), Postives = 36/59 (61.02%), Query Frame = 1
Query:   40 CDSKCAERCKQAGVQDRCLKYCGICCEDCKCVPSGTYGNKHECPCYRDKVNKKGKPKCP 216
            C  KC  RC +   +  C+ +C  CC  C CVP+GTYGNK  CPCY +   K+G PKCP
Sbjct:   54 CQPKCTYRCSKTSYKKPCMFFCQKCCAKCLCVPAGTYGNKQSCPCYNNWKTKRGGPKCP 112          
BLAST of EY755985 vs. ExPASy Swiss-Prot
Match: RSI1_SOLLC (Protein RSI-1 OS=Solanum lycopersicum GN=RSI-1 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.100e-13
Identity = 27/59 (45.76%), Postives = 34/59 (57.63%), Query Frame = 1
Query:   40 CDSKCAERCKQAGVQDRCLKYCGICCEDCKCVPSGTYGNKHECPCYRDKVNKKGKPKCP 216
            C  +C  RC     +  C+ +C  CC  C CVP G YGNK  CPCY +   ++GKPKCP
Sbjct:   38 CKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP 96          
BLAST of EY755985 vs. ExPASy Swiss-Prot
Match: GASA4_ARATH (Gibberellin-regulated protein 4 OS=Arabidopsis thaliana GN=GASA4 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 6.109e-13
Identity = 27/59 (45.76%), Postives = 34/59 (57.63%), Query Frame = 1
Query:   40 CDSKCAERCKQAGVQDRCLKYCGICCEDCKCVPSGTYGNKHECPCYRDKVNKKGKPKCP 216
            C S+C  RCK+      C+ +C  CC  C CVP G YGNK  C CY +   ++G PKCP
Sbjct:   48 CPSECDRRCKKTQYHKACITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP 106          
BLAST of EY755985 vs. ExPASy Swiss-Prot
Match: GASA2_ARATH (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana GN=GASA2 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.172e-12
Identity = 26/59 (44.07%), Postives = 32/59 (54.24%), Query Frame = 1
Query:   40 CDSKCAERCKQAGVQDRCLKYCGICCEDCKCVPSGTYGNKHECPCYRDKVNKKGKPKCP 216
            C  +C +RC ++     CL+ C  CC  C CVP GT GN H CPCY       G+ KCP
Sbjct:   41 CGGRCKDRCSKSSRTKLCLRACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCP 99          
BLAST of EY755985 vs. ExPASy Swiss-Prot
Match: GASA3_ARATH (Gibberellin-regulated protein 3 OS=Arabidopsis thaliana GN=GASA3 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.754e-12
Identity = 26/59 (44.07%), Postives = 33/59 (55.93%), Query Frame = 1
Query:   40 CDSKCAERCKQAGVQDRCLKYCGICCEDCKCVPSGTYGNKHECPCYRDKVNKKGKPKCP 216
            C  +C  RC ++   + CL+ C  CC  C CVP GT GN H CPCY     + G+ KCP
Sbjct:   41 CGGRCKGRCSKSSRPNLCLRACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP 99          
BLAST of EY755985 vs. ExPASy Swiss-Prot
Match: GASA1_ARATH (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana GN=GASA1 PE=1 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 7.468e-11
Identity = 26/59 (44.07%), Postives = 31/59 (52.54%), Query Frame = 1
Query:   40 CDSKCAERCKQAGVQDRCLKYCGICCEDCKCVPSGTYGNKHECPCYRDKVNKKGKPKCP 216
            C S C  RC+ +     C + CG CC  C CVP GTYGN  +C CY       G+ KCP
Sbjct:   40 CGSACVARCRLSRRPRLCHRACGTCCYRCNCVPPGTYGNYDKCQCYASLTTHGGRRKCP 98          
BLAST of EY755985 vs. ExPASy Swiss-Prot
Match: SNAK2_SOLTU (Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.753e-11
Identity = 26/59 (44.07%), Postives = 29/59 (49.15%), Query Frame = 1
Query:   40 CDSKCAERCKQAGVQDRCLKYCGICCEDCKCVPSGTYGNKHECPCYRDKVNKKGKPKCP 216
            C   CA RC+ +     C + CG CC  C CVP GT GN   CPCY        K KCP
Sbjct:   46 CGGACAARCRLSSRPRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP 104          
The following BLAST results are available for this feature:
BLAST of EY755985 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
SNAK1_SOLTU8.485e-3175.00Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1[more]
GAST1_SOLLC8.524e-1549.15Protein GAST1 OS=Solanum lycopersicum GN=GAST1 PE=... [more]
RSI1_SOLLC2.100e-1345.76Protein RSI-1 OS=Solanum lycopersicum GN=RSI-1 PE=... [more]
GASA4_ARATH6.109e-1345.76Gibberellin-regulated protein 4 OS=Arabidopsis tha... [more]
GASA2_ARATH5.172e-1244.07Gibberellin-regulated protein 2 OS=Arabidopsis tha... [more]
GASA3_ARATH6.754e-1244.07Gibberellin-regulated protein 3 OS=Arabidopsis tha... [more]
GASA1_ARATH7.468e-1144.07Gibberellin-regulated protein 1 OS=Arabidopsis tha... [more]
SNAK2_SOLTU9.753e-1144.07Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1[more]
back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-C07-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755985 ID=EY755985|Name=EY755985|organism=Citrus sinensis|type=EST|length=414bp
CCACGCGTCCGGGAGCCTGCCACCGCTGGATCACCCTTTTGTGACAGCAA
GTGTGCGGAAAGGTGCAAGCAAGCAGGAGTGCAGGACCGGTGCTTGAAGT
ACTGCGGGATATGCTGTGAGGACTGCAAGTGTGTGCCTTCTGGGACTTAC
GGAAACAAGCATGAGTGCCCTTGCTACAGGGACAAGGTTAACAAGAAGGG
GAAGCCCAAGTGCCCTTGAATTTCGAAACCGCATCAAAATTCAAATGCAT
CTGCTTTAATTATGTTCTGTAAACAGTATTATTATTATTGGTAGTATTAT
ATTATGATGGTGGTGGAATGTTAATGCACTTATATTATTCTTAAATAATA
AAAGCTATTTCTCTTGGTGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA
back to top