EY755969

Overview
NameEY755969
Unique NameEY755969
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length515
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10377 contig Csv1_Contig10377:421..935. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT_SOLTU (Caffeoyl-CoA O-methyltransferase OS=Solanum tuberosum GN=CCOAOMT PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.511e-43
Identity = 81/111 (72.97%), Postives = 96/111 (86.49%), Query Frame = 1
Query:    4 RVRPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            R  PALP+LDQ+I+D KYHG++DF+FVDADK+NY+NYHKRLI+LVKVGG+IGYDNTLW GSVVA PDA L + +  +RD V ELNKALA DPRIEICQL + DG+TLCRRI
Sbjct:  131 REGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRRI 241          
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT_POPTM (Caffeoyl-CoA O-methyltransferase OS=Populus tremuloides PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.511e-43
Identity = 81/108 (75.00%), Postives = 94/108 (87.04%), Query Frame = 1
Query:   13 PALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            PALP+LDQ+I+D KYHG+FDF+FVDADK+NYINYHKRLIELVKVGG+IGYDNTLW GSVVA PDA + + +  +RD V ELNKALA DPRIEIC L + DG+TLCRRI
Sbjct:  139 PALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 246          
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT2_EUCGL (Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus globulus GN=CCOAOMT2 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.511e-43
Identity = 82/111 (73.87%), Postives = 95/111 (85.59%), Query Frame = 1
Query:    4 RVRPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            R  PALPLLDQL+QDEK HGT+DF+FVDADK+NYINYHKRLI+LVKVGG+IGYDNTLW GSVVA  DA L + +  +RD V ELNKALAVDPR+EIC L + DG+TLCRR+
Sbjct:  136 REGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGLIGYDNTLWNGSVVAPADAPLRKYVRYYRDFVLELNKALAVDPRVEICMLPVGDGITLCRRV 246          
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT_VITVI (Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 3.366e-43
Identity = 79/108 (73.15%), Postives = 94/108 (87.04%), Query Frame = 1
Query:   13 PALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            PALP+LDQ+I+D KYHG+FDF+FVDADK+NY+NYHKRLI+LVKVGG+IGYDNTLW GSVVA PDA L + +  +RD V ELNKALA DPRIEIC L + DG+TLCRR+
Sbjct:  134 PALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGIIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRL 241          
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT_ZINEL (Caffeoyl-CoA O-methyltransferase OS=Zinnia elegans GN=CCOAOMT PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 5.741e-43
Identity = 81/111 (72.97%), Postives = 95/111 (85.59%), Query Frame = 1
Query:    4 RVRPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            R  PALPLLDQ++QDEK HG+FDF+FVDADK+NY+NYHKRLI+LVK GGVIGYDNTLW GS+VA  DA L + +  +RD V ELNKALAVDPR+EICQL + DG+TLCRRI
Sbjct:  134 REGPALPLLDQMLQDEKCHGSFDFIFVDADKDNYLNYHKRLIDLVKFGGVIGYDNTLWNGSLVAPADAPLRKYVRYYRDFVLELNKALAVDPRVEICQLPVGDGITLCRRI 244          
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT_MEDSA (Caffeoyl-CoA O-methyltransferase OS=Medicago sativa GN=CCOMT PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 7.499e-43
Identity = 80/111 (72.07%), Postives = 96/111 (86.49%), Query Frame = 1
Query:    4 RVRPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            R  PALP+LD++I+DEK HG++DF+FVDADK+NY+NYHKRLI+LVKVGGVIGYDNTLW GSVVA PDA L + +  +RD V ELNKALAVDPRIEIC L + DG+T+CRRI
Sbjct:  136 REGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI 246          
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT2_POPTR (Caffeoyl-CoA O-methyltransferase 2 OS=Populus trichocarpa GN=CCOAOMT2 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 9.793e-43
Identity = 80/108 (74.07%), Postives = 93/108 (86.11%), Query Frame = 1
Query:   13 PALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            PALP+LDQ+I+D KYHGT+DF+FVDADK+NYINYHKRLIELVKVGG+IGYDNTLW GSVVA  DA + + +  +RD V ELNKALA DPRIEIC L + DG+TLCRRI
Sbjct:  139 PALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 246          
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT5_TOBAC (Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana tabacum GN=CCOAOMT5 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.279e-42
Identity = 79/111 (71.17%), Postives = 95/111 (85.59%), Query Frame = 1
Query:    4 RVRPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            R  PALP+LDQL++D+K HGT+DF+FVDADK+NYINYHKR+I+LVKVGG+IGYDNTLW GSVVA PDA + + +  +RD V ELNKALA DPRIEIC L + DG+TLCRRI
Sbjct:  129 REGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 239          
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT2_TOBAC (Caffeoyl-CoA O-methyltransferase 2 OS=Nicotiana tabacum GN=CCOAOMT2 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.279e-42
Identity = 80/111 (72.07%), Postives = 95/111 (85.59%), Query Frame = 1
Query:    4 RVRPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            R  PALP+LDQ+I+D KYHG++DF+FVDADK+NY+NYHKRLI+LVKVGG+IGYDNTLW GSVVA PDA L + +  +RD V ELNKALA D RIEICQL + DG+TLCRRI
Sbjct:  131 REGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRRI 241          
BLAST of EY755969 vs. ExPASy Swiss-Prot
Match: CAMT3_TOBAC (Caffeoyl-CoA O-methyltransferase 3 OS=Nicotiana tabacum GN=CCOAOMT3 PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 1.670e-42
Identity = 79/108 (73.15%), Postives = 94/108 (87.04%), Query Frame = 1
Query:   13 PALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDADLDELILGWRDSVQELNKALAVDPRIEICQLSIADGVTLCRRI 336
            PALP+LDQ+I+D KYHG++DF+FVDADK+NY+NYHKRLI+LVKVGG+IGYDNTLW GSVVA PDA L + +  +RD V ELNKALA D RIEICQL + DG+TLCRRI
Sbjct:  134 PALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADSRIEICQLPVGDGITLCRRI 241          
The following BLAST results are available for this feature:
BLAST of EY755969 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
CAMT_SOLTU1.511e-4372.97Caffeoyl-CoA O-methyltransferase OS=Solanum tubero... [more]
CAMT_POPTM1.511e-4375.00Caffeoyl-CoA O-methyltransferase OS=Populus tremul... [more]
CAMT2_EUCGL1.511e-4373.87Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus g... [more]
CAMT_VITVI3.366e-4373.15Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera... [more]
CAMT_ZINEL5.741e-4372.97Caffeoyl-CoA O-methyltransferase OS=Zinnia elegans... [more]
CAMT_MEDSA7.499e-4372.07Caffeoyl-CoA O-methyltransferase OS=Medicago sativ... [more]
CAMT2_POPTR9.793e-4374.07Caffeoyl-CoA O-methyltransferase 2 OS=Populus tric... [more]
CAMT5_TOBAC1.279e-4271.17Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana ta... [more]
CAMT2_TOBAC1.279e-4272.07Caffeoyl-CoA O-methyltransferase 2 OS=Nicotiana ta... [more]
CAMT3_TOBAC1.670e-4273.15Caffeoyl-CoA O-methyltransferase 3 OS=Nicotiana ta... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-002-B01-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755969 ID=EY755969|Name=EY755969|organism=Citrus sinensis|type=EST|length=515bp
CCACGCGTCCGCCCTGCTCTTCCTCTTCTTGATCAATTGATCCAAGACGA
AAAATATCATGGGACATTCGACTTCGTCTTTGTTGATGCTGACAAGAATA
ACTACATTAATTACCACAAGAGGCTTATTGAGCTTGTGAAGGTTGGGGGA
GTGATTGGCTACGACAACACCTTGTGGGGTGGATCTGTGGTGGCACAACC
TGATGCCGACCTGGATGAGCTAATCTTAGGCTGGAGGGATTCTGTGCAGG
AACTCAACAAGGCCCTGGCCGTTGATCCAAGGATTGAGATTTGCCAGCTC
TCCATTGCTGATGGGGTTACATTATGTCGTCGCATTGGCTGATCCTCTCA
ATTTTCACTCACGAGACTGGTTGTGTCGTAACTTTTAAACTATACTATGT
GTGGTTATGACAGTAAAATCCACAAATAAATTAGACCGATGAGTGTTTGG
AGAAATGTATTATTGTTTTTCTTAAGTTAATAAATTTTTAAAAATAAAAA
AAAAAAAAAAAAAAA
back to top