EY755886

Overview
NameEY755886
Unique NameEY755886
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1515 contig Csv1_Contig1515:233..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY755886 vs. ExPASy Swiss-Prot
Match: GASA4_ARATH (Gibberellin-regulated protein 4 OS=Arabidopsis thaliana GN=GASA4 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 6.665e-17
Identity = 35/60 (58.33%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  252 ECPGKCDTRCSQTQYRKPXXXXXXXXXXXXXXVPPGYYGNKAVCPCYNNWKTKEGGPKCP 431
            +CP +CD RC +TQY K               VPPGYYGNK VC CYNNWKT+EGGPKCP
Sbjct:   47 QCPSECDRRCKKTQYHKACITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP 106          
BLAST of EY755886 vs. ExPASy Swiss-Prot
Match: GAST1_SOLLC (Protein GAST1 OS=Solanum lycopersicum GN=GAST1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.815e-14
Identity = 33/60 (55.00%), Postives = 36/60 (60.00%), Query Frame = 3
Query:  252 ECPGKCDTRCSQTQYRKPXXXXXXXXXXXXXXVPPGYYGNKAVCPCYNNWKTKEGGPKCP 431
            +C  KC  RCS+T Y+KP              VP G YGNK  CPCYNNWKTK GGPKCP
Sbjct:   53 DCQPKCTYRCSKTSYKKPCMFFCQKCCAKCLCVPAGTYGNKQSCPCYNNWKTKRGGPKCP 112          
BLAST of EY755886 vs. ExPASy Swiss-Prot
Match: RSI1_SOLLC (Protein RSI-1 OS=Solanum lycopersicum GN=RSI-1 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.301e-12
Identity = 30/60 (50.00%), Postives = 35/60 (58.33%), Query Frame = 3
Query:  252 ECPGKCDTRCSQTQYRKPXXXXXXXXXXXXXXVPPGYYGNKAVCPCYNNWKTKEGGPKCP 431
            +C  +C  RCS T ++KP              VP G YGNK  CPCYNNWKT+EG PKCP
Sbjct:   37 DCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP 96          
The following BLAST results are available for this feature:
BLAST of EY755886 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
GASA4_ARATH6.665e-1758.33Gibberellin-regulated protein 4 OS=Arabidopsis tha... [more]
GAST1_SOLLC1.815e-1455.00Protein GAST1 OS=Solanum lycopersicum GN=GAST1 PE=... [more]
RSI1_SOLLC1.301e-1250.00Protein RSI-1 OS=Solanum lycopersicum GN=RSI-1 PE=... [more]
back to top
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Properties
Property NameValue
Genbank descriptionCS13-C1-001-001-A06-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY755886 ID=EY755886|Name=EY755886|organism=Citrus sinensis|type=EST|length=744bp
TTCGATAGACCCACGCGTCCGAGAGCTACCTTACGTTTCTCAAGTCTCAA
ATAACCGTTTTCCATTAATTATTCACTTCCAAAAAGCTAAAAGCACAATG
ACCGATGTATGTGGGTAGAGCAGAGAGTCCAAGTGTGGTCAAAACTCTTC
GAAAGTTACAAAAGATAATGATGGTTTTATTTTTTTGACTATTTGTTTAT
TTTTTTATTTATAATAAAGAATTCTCAAATCACATGTGTCTGGAATGACC
AGAATGCCCTGGAAAATGTGATACGAGATGCAGCCAGACCCAATACCGCA
AGCCATGCCTATTCTTTTGCAACAAGTGCTGCAAGAAGTGTCTGTGTGTG
CCCCCTGGCTACTATGGCAACAAGGCTGTGTGCCCTTGCTACAACAATTG
GAAGACCAAGGAAGGAGGACCTAAATGCCCTTAAGCAGTCAGCTCTTCGC
TTTCAAAATCTCTTCCTCTTTATCGTCACCTATTTTAAGTTTCGTTTTGT
TGTATTATCATCACAGCCACTGTGATGTTGTTCGACTATTACTTACTAAC
TTCAAAGTTCAATACGCACCGGCCAGCCCCTTTTTCCTATATGTNGGGGG
TTCTTTTGATGTGAGTCACTCCTTGAGGATTNAGGATTAACCTCCCTCTA
ATGAGAGTGGCTAATCTATGATGTATTATCATATTACAATGTCAATGAAG
TTTCTTATTTACTGTTAAAAAAAAAAAAAAAAAAAAAAGGGCCG
back to top