EY728719

Overview
NameEY728719
Unique NameEY728719
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length658
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_PSEPF (Error-prone DNA polymerase OS=Pseudomonas fluorescens (strain Pf0-1) GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.823e-34
Identity = 70/79 (88.61%), Postives = 75/79 (94.94%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDF 239
            RPGTASGVTFVTLEDEFGN+NVVVWRDLAERQRQ LVGS+LLKVDGRWE  GEVRHLIAGRL+DLTPLL+GI V+SRDF
Sbjct:  946 RPGTASGVTFVTLEDEFGNVNVVVWRDLAERQRQVLVGSQLLKVDGRWEREGEVRHLIAGRLSDLTPLLNGIRVQSRDF 1024          
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_PSEF5 (Error-prone DNA polymerase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.313e-31
Identity = 67/80 (83.75%), Postives = 73/80 (91.25%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDFR 242
            RPGTASGVTFVTLEDEFGN+NVVVWRDLAERQR+ LVG++LLKVDG  E  GEVRHLIAGRL+DL+PLL GI VRSRDFR
Sbjct:  955 RPGTASGVTFVTLEDEFGNVNVVVWRDLAERQRRVLVGAQLLKVDGTLETEGEVRHLIAGRLSDLSPLLDGIHVRSRDFR 1034          
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_PSEU2 (Error-prone DNA polymerase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.503e-27
Identity = 62/80 (77.50%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDFR 242
            RPGTASGVTFVTLEDEFG +NVVVWRDLAERQR+ LVGS+LL+V GR E+   VRHLIA RL DLTPLL+G+ VRSRDF+
Sbjct:  952 RPGTASGVTFVTLEDEFGMVNVVVWRDLAERQRKVLVGSQLLQVFGRLESKSGVRHLIAQRLYDLTPLLTGLDVRSRDFQ 1031          
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_PSE14 (Error-prone DNA polymerase OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.503e-27
Identity = 62/80 (77.50%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDFR 242
            RPGTASGVTFVTLEDEFG +NVVVWRDLAERQR+ LVGS+LL+V GR E+   VRHLIA RL DLTPLL+G+ VRSRDF+
Sbjct:  952 RPGTASGVTFVTLEDEFGMVNVVVWRDLAERQRKVLVGSQLLQVFGRLESKSGVRHLIAQRLYDLTPLLTGLDVRSRDFQ 1031          
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_PSESM (Error-prone DNA polymerase OS=Pseudomonas syringae pv. tomato GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.963e-27
Identity = 62/80 (77.50%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDFR 242
            RPGTASGVTFVTLEDEFG +NVVVWRDLAERQR+ LVGS+LL+V GR E+   VRHLIA RL DLTPLL+G+ VRSRDF+
Sbjct:  952 RPGTASGVTFVTLEDEFGMVNVVVWRDLAERQRKVLVGSQLLQVFGRLESNNGVRHLIAQRLYDLTPLLTGLEVRSRDFQ 1031          
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_PSEMY (Error-prone DNA polymerase OS=Pseudomonas mendocina (strain ymp) GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.406e-25
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDF 239
            RP TASGV FVTLEDEFG +NVVVW DLAERQR+ L+ SRLL++DG  E+   VRH+IAGRLTDL+PLL+G+ V+SRDF
Sbjct:  947 RPQTASGVIFVTLEDEFGMVNVVVWHDLAERQRRVLLQSRLLRIDGHLESADGVRHVIAGRLTDLSPLLTGLDVKSRDF 1025          
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_PSEPK (Error-prone DNA polymerase OS=Pseudomonas putida (strain KT2440) GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 5.344e-25
Identity = 59/79 (74.68%), Postives = 65/79 (82.28%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDF 239
            RP TASGVTFVTLEDE G +NVVVWR LAERQR+ALVGS+LLKV GR E    VRHLIA RL D++PLL G+ VRSRDF
Sbjct:  954 RPQTASGVTFVTLEDEHGMVNVVVWRALAERQRRALVGSQLLKVSGRLEQENGVRHLIARRLEDVSPLLQGLDVRSRDF 1032          
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_PSEA7 (Error-prone DNA polymerase OS=Pseudomonas aeruginosa (strain PA7) GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 5.344e-25
Identity = 56/79 (70.89%), Postives = 66/79 (83.54%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDF 239
            RP TASGVTF+TLEDEFG +NVVVW DLAERQR+  + SRLL+V+G  E+   VRH+IAGRL DLTPLL+G+ VRSRDF
Sbjct:  945 RPQTASGVTFITLEDEFGMVNVVVWHDLAERQRRPFLESRLLQVEGTLESSSGVRHVIAGRLQDLTPLLTGLDVRSRDF 1023          
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_PSEAE (Error-prone DNA polymerase OS=Pseudomonas aeruginosa GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.031e-24
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDF 239
            RP TASG+TF+TLEDEFG +NVVV  DLAERQR+  + SRLL+V+G  E+ GEVRH+IAGRL DLTPLL+G+ VRSRDF
Sbjct:  952 RPQTASGITFITLEDEFGMVNVVVRHDLAERQRRPFLESRLLQVEGILESSGEVRHVIAGRLHDLTPLLTGLDVRSRDF 1030          
BLAST of EY728719 vs. ExPASy Swiss-Prot
Match: DNAE2_ALHEH (Error-prone DNA polymerase OS=Alkalilimnicola ehrlichei (strain MLHE-1) GN=dnaE2 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.153e-19
Identity = 47/79 (59.49%), Postives = 57/79 (72.15%), Query Frame = 3
Query:    3 RPGTASGVTFVTLEDEFGNINVVVWRDLAERQRQALVGSRLLKVDGRWEAVGEVRHLIAGRLTDLTPLLSGISVRSRDF 239
            RPG+A GVTF+TLEDE G IN+VVW+  AE QR+ L+ +RLL V G WE  G V HL+AGRL D +  L  + VRSRDF
Sbjct:  946 RPGSAGGVTFLTLEDETGQINLVVWKATAEAQRRTLLAARLLMVSGIWERKGAVTHLVAGRLEDWSDWLGALDVRSRDF 1024          
The following BLAST results are available for this feature:
BLAST of EY728719 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
DNAE2_PSEPF4.823e-3488.61Error-prone DNA polymerase OS=Pseudomonas fluoresc... [more]
DNAE2_PSEF51.313e-3183.75Error-prone DNA polymerase OS=Pseudomonas fluoresc... [more]
DNAE2_PSEU21.503e-2777.50Error-prone DNA polymerase OS=Pseudomonas syringae... [more]
DNAE2_PSE141.503e-2777.50Error-prone DNA polymerase OS=Pseudomonas syringae... [more]
DNAE2_PSESM1.963e-2777.50Error-prone DNA polymerase OS=Pseudomonas syringae... [more]
DNAE2_PSEMY1.406e-2570.89Error-prone DNA polymerase OS=Pseudomonas mendocin... [more]
DNAE2_PSEPK5.344e-2574.68Error-prone DNA polymerase OS=Pseudomonas putida (... [more]
DNAE2_PSEA75.344e-2570.89Error-prone DNA polymerase OS=Pseudomonas aerugino... [more]
DNAE2_PSEAE2.031e-2470.89Error-prone DNA polymerase OS=Pseudomonas aerugino... [more]
DNAE2_ALHEH1.153e-1959.49Error-prone DNA polymerase OS=Alkalilimnicola ehrl... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-007-F09-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728719 ID=EY728719|Name=EY728719|organism=Citrus sinensis|type=EST|length=658bp
AACGTCCGGGCACGGCCAGCGGCGTCACCTTCGTCACCCTGGAAGATGAG
TTCGGCAATATCAATGTGGTGGTCTGGCGCGATTTGGCCGAGCGGCAGCG
CCAGGCGCTGGTGGGCTCGCGGTTGCTCAAAGTCGATGGCCGCTGGGAGG
CGGTGGGGGAGGTTCGGCACCTGATCGCCGGGCGCCTGACCGACCTGACC
CCGCTGCTGTCGGGCATCAGTGTGCGCAGCCGGGATTTTCGCTGATCCGG
CTCTTGCTCCTTCATGGCCGCATAAGCAATATGCGATGAAACCAACCGCC
GCTGTCGGGCTCAAAGTTTTCATCGCCGCCCACCTTTTATCTTTTGCAGA
GCCGACTGATGCAGTTTTTATCCGATACCCATGGCTGTGATGGCTGGGCT
GGGGAAATGGCCCAGAGGATTCGCGCATTCGATTGGTCCGGCACCGACCT
CGGCCCGATTGGTGCCTGGCCCTCCAGCCTGGTCAGCGCCGTGCAGATGA
TGCTGGCATCGCCCTCCCTATGGTCTGCTGGNGGGAAGGGCGGGTTAATG
ATCTACACGACANTNTTCCGTGTTGCCGGGGCCGCTCTAAGATCCAGCTA
CTACGCGTGCTGCGACTCTAGTCTTATATGTCCTAATCATCCTGCTTATA
GACTCTCG
back to top