EY728594

Overview
NameEY728594
Unique NameEY728594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length813
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: AL3H1_ARATH (Aldehyde dehydrogenase family 3 member H1 OS=Arabidopsis thaliana GN=ALDH3H1 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 1.111e-25
Identity = 44/90 (48.89%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  120 EVFDAEAASLFVKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEVAXXXXXXXXXXXXXXHWMTPEK 389
            +VF +  AS  V ELR +F  G T+ Y WRV+ LK LM + +  EP+IV ALR DL KPELESSVYEV+              +WM PEK
Sbjct:    5 KVFGSAEASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVYEVSLLRNSIKLALKQLKNWMAPEK 94          

HSP 2 Score: 53.5286 bits (127), Expect = 1.111e-25
Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 1
Query:  427 ELVPHPLGVVLLISAWHNPFLSSLDPLVGAIAAGMA 534
            E+V  PLGVVL+ISAW+ PFL S+DP++GAI+AG A
Sbjct:  107 EIVSEPLGVVLVISAWNYPFLLSIDPVIGAISAGNA 142          
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: AL3I1_ARATH (Aldehyde dehydrogenase family 3 member I1, chloroplastic OS=Arabidopsis thaliana GN=ALDH3I1 PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 2.152e-23
Identity = 37/87 (42.53%), Postives = 54/87 (62.07%), Query Frame = 3
Query:  126 FDAEAASLFVKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEVAXXXXXXXXXXXXXXHWMTPE 386
            F  + A+L V ELR  F SG+TKSY WR+S L+++ +M++E+E  I +AL QDL KPELE+ + E++              +WM PE
Sbjct:   70 FSGKEAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLAEISNTKSSCMLAIKELKNWMAPE 156          

HSP 2 Score: 51.2174 bits (121), Expect = 2.152e-23
Identity = 23/36 (63.89%), Postives = 31/36 (86.11%), Query Frame = 1
Query:  427 ELVPHPLGVVLLISAWHNPFLSSLDPLVGAIAAGMA 534
            ++V  PLGVVL+ISAW+ PFL S++P++GAIAAG A
Sbjct:  170 QIVSEPLGVVLVISAWNFPFLLSVEPVIGAIAAGNA 205          
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: ALDH_CRAPL (Aldehyde dehydrogenase OS=Craterostigma plantagineum GN=ALDH PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 6.606e-22
Identity = 38/87 (43.68%), Postives = 50/87 (57.47%), Query Frame = 3
Query:  129 DAEAASLFVKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEVAXXXXXXXXXXXXXXHWMTPEK 389
            DAE     V  LR T+ SGKTKSY WRVS LK+L+K+    + ++V+ALR DL KPE E+ V+E+                WM P+K
Sbjct:    5 DAEGV---VDGLRRTYISGKTKSYEWRVSQLKALLKITTHHDKEVVEALRADLKKPEHEAYVHEIFMVSNACKSALKELHQWMKPQK 88          

HSP 2 Score: 52.7582 bits (125), Expect = 6.606e-22
Identity = 23/34 (67.65%), Postives = 30/34 (88.24%), Query Frame = 1
Query:  427 ELVPHPLGVVLLISAWHNPFLSSLDPLVGAIAAG 528
            E+V  PLGVVL+I+AW+ PFL +LDP++GAIAAG
Sbjct:  101 EIVSEPLGVVLVITAWNYPFLLALDPMIGAIAAG 134          
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: AL3A2_RAT (Fatty aldehyde dehydrogenase OS=Rattus norvegicus GN=Aldh3a2 PE=1 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 1.699e-14
Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 1
Query:  436 PHPLGVVLLISAWHNPFLSSLDPLVGAIAAGMA 534
            P PLGVVL+I AW+ PF+ +L PLVGAIAAG A
Sbjct:   99 PEPLGVVLIIGAWNYPFVLTLQPLVGAIAAGNA 131          

HSP 2 Score: 48.9062 bits (115), Expect = 1.699e-14
Identity = 24/57 (42.11%), Postives = 38/57 (66.67%), Query Frame = 3
Query:  153 VKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEV 323
            V+ LR TF SG+++   +R+  L++L +M+ ERE DI+ A+  DL K EL +  +EV
Sbjct:    5 VQRLRQTFRSGRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLSKSELNAYSHEV 61          
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: AL3A2_MOUSE (Fatty aldehyde dehydrogenase OS=Mus musculus GN=Aldh3a2 PE=2 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 8.593e-13
Identity = 22/33 (66.67%), Postives = 27/33 (81.82%), Query Frame = 1
Query:  436 PHPLGVVLLISAWHNPFLSSLDPLVGAIAAGMA 534
            P PLGVVL+I AW+ PF+ ++ PLVGAIAAG A
Sbjct:   99 PEPLGVVLIIGAWNYPFVLTMQPLVGAIAAGNA 131          

HSP 2 Score: 43.8986 bits (102), Expect = 8.593e-13
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 3
Query:  153 VKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEV 323
            V  LR  F SG+++   +R+  L++L +M+ ERE +I+ A+  DL K EL +  +EV
Sbjct:    5 VLRLRQAFRSGRSRLLRFRLQQLEALRRMVQEREKEILAAIAADLSKSELNAYSHEV 61          
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: AL3A2_MACFA (Fatty aldehyde dehydrogenase OS=Macaca fascicularis GN=ALDH3A2 PE=2 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 1.882e-12
Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 1
Query:  436 PHPLGVVLLISAWHNPFLSSLDPLVGAIAAGMA 534
            P PLGVVL+I AW+ PF+  + PL+GAIAAG A
Sbjct:   99 PQPLGVVLIIGAWNYPFVLIIQPLIGAIAAGNA 131          

HSP 2 Score: 44.2838 bits (103), Expect = 1.882e-12
Identity = 24/76 (31.58%), Postives = 39/76 (51.32%), Query Frame = 3
Query:  153 VKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEVAXXXXXXXXXXXXXXHWMT 380
            V+ +R  F SG+++   +R+  L++L +M+ ERE DI+ A+  DL K EL +   EV                W+T
Sbjct:    5 VQRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLCKSELNAYSQEVITVLGEIDFMLENLPEWVT 80          
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: AL3A2_HUMAN (Fatty aldehyde dehydrogenase OS=Homo sapiens GN=ALDH3A2 PE=1 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 2.443e-12
Identity = 21/33 (63.64%), Postives = 27/33 (81.82%), Query Frame = 1
Query:  436 PHPLGVVLLISAWHNPFLSSLDPLVGAIAAGMA 534
            P PLGVVL+I AW+ PF+ ++ PL+GAIAAG A
Sbjct:   99 PQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNA 131          

HSP 2 Score: 42.743 bits (99), Expect = 2.443e-12
Identity = 24/78 (30.77%), Postives = 38/78 (48.72%), Query Frame = 3
Query:  147 LFVKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEVAXXXXXXXXXXXXXXHWMT 380
            L V+ +R  F SG+++   +R+  L++L +M+ ERE DI+ A+  DL K E      EV                W+T
Sbjct:    3 LEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLENLPEWVT 80          
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: AL3A2_PONAB (Fatty aldehyde dehydrogenase OS=Pongo abelii GN=ALDH3A2 PE=2 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.173e-12
Identity = 21/33 (63.64%), Postives = 27/33 (81.82%), Query Frame = 1
Query:  436 PHPLGVVLLISAWHNPFLSSLDPLVGAIAAGMA 534
            P PLGVVL+I AW+ PF+ ++ PL+GAIAAG A
Sbjct:   99 PQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNA 131          

HSP 2 Score: 42.3578 bits (98), Expect = 3.173e-12
Identity = 24/78 (30.77%), Postives = 38/78 (48.72%), Query Frame = 3
Query:  147 LFVKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEVAXXXXXXXXXXXXXXHWMT 380
            L V+ +R  F SG+++   +R+  L++L +M+ ERE DI+ A+  DL K E      EV                W+T
Sbjct:    3 LEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLCKSEFNVYSQEVITVLGEIDFMLENLPEWVT 80          
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: AL3F1_ARATH (Aldehyde dehydrogenase family 3 member F1 OS=Arabidopsis thaliana GN=ALDH3F1 PE=1 SV=2)

HSP 1 Score: 46.595 bits (109), Expect = 9.016e-12
Identity = 24/78 (30.77%), Postives = 40/78 (51.28%), Query Frame = 3
Query:  153 VKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEVAXXXXXXXXXXXXXXHWMTPE 386
            ++E+R TFASG+T+S  WR + + ++ +M+ + E  I +AL QDL K   E+   E+                W  P+
Sbjct:   12 LREMRETFASGRTRSLKWRKAQIGAIYEMVKDNEDKICNALFQDLGKHSTEAFRDELGVVLRTATVAINCLDKWAVPK 89          

HSP 2 Score: 43.1282 bits (100), Expect = 9.016e-12
Identity = 18/34 (52.94%), Postives = 26/34 (76.47%), Query Frame = 1
Query:  427 ELVPHPLGVVLLISAWHNPFLSSLDPLVGAIAAG 528
            +++  P G VL++S+W+ P   SLDPL+GAIAAG
Sbjct:  103 KVISEPYGTVLVLSSWNFPISLSLDPLIGAIAAG 136          
BLAST of EY728594 vs. ExPASy Swiss-Prot
Match: AL3A1_RAT (Aldehyde dehydrogenase, dimeric NADP-preferring OS=Rattus norvegicus GN=Aldh3a1 PE=1 SV=3)

HSP 1 Score: 45.8246 bits (107), Expect = 1.173e-11
Identity = 26/58 (44.83%), Postives = 33/58 (56.90%), Query Frame = 3
Query:  153 VKELRGTFASGKTKSYGWRVSHLKSLMKMLNEREPDIVDALRQDLDKPELESSVYEVA 326
            VK  R  F SGKT+S  +R+  L++L +M+NE    I  AL  DL K E  S   EVA
Sbjct:    8 VKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLGKNEWTSYYEEVA 65          

HSP 2 Score: 43.5134 bits (101), Expect = 1.173e-11
Identity = 19/31 (61.29%), Postives = 25/31 (80.65%), Query Frame = 1
Query:  442 PLGVVLLISAWHNPFLSSLDPLVGAIAAGMA 534
            PLGVVL+I AW+ PF  ++ P+VGA+AAG A
Sbjct:  104 PLGVVLVIGAWNYPFNLTIQPMVGAVAAGNA 134          
The following BLAST results are available for this feature:
BLAST of EY728594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
AL3H1_ARATH1.111e-2548.89Aldehyde dehydrogenase family 3 member H1 OS=Arabi... [more]
AL3I1_ARATH2.152e-2342.53Aldehyde dehydrogenase family 3 member I1, chlorop... [more]
ALDH_CRAPL6.606e-2243.68Aldehyde dehydrogenase OS=Craterostigma plantagine... [more]
AL3A2_RAT1.699e-1469.70Fatty aldehyde dehydrogenase OS=Rattus norvegicus ... [more]
AL3A2_MOUSE8.593e-1366.67Fatty aldehyde dehydrogenase OS=Mus musculus GN=Al... [more]
AL3A2_MACFA1.882e-1263.64Fatty aldehyde dehydrogenase OS=Macaca fasciculari... [more]
AL3A2_HUMAN2.443e-1263.64Fatty aldehyde dehydrogenase OS=Homo sapiens GN=AL... [more]
AL3A2_PONAB3.173e-1263.64Fatty aldehyde dehydrogenase OS=Pongo abelii GN=AL... [more]
AL3F1_ARATH9.016e-1230.77Aldehyde dehydrogenase family 3 member F1 OS=Arabi... [more]
AL3A1_RAT1.173e-1144.83Aldehyde dehydrogenase, dimeric NADP-preferring OS... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-005-H12-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728594 ID=EY728594|Name=EY728594|organism=Citrus sinensis|type=EST|length=813bp
CACGCGTCCGTGTTTGTAACCGAAGCCAAAAAANAAAAAACAGAATTCCG
AAATCCATCTGTCCTTCTCTCGCTTTGTCAATTGCAATGGGGAGTGAGGA
GGAGACGAACAAAAACAATGAGGTGTTCGATGCGGAGGCGGCGAGCTTGT
TCGTGAAGGAGCTGAGAGGAACTTTTGCGTCTGGAAAAACGAAGAGCTAC
GGATGGAGAGTGTCTCACTTGAAGAGTTTGATGAAGATGCTTAACGAGCG
CGAGCCGGACATCGTCGACGCTCTTCGTCAAGATCTCGATAAGCCGGAAC
TTGAATCCTCCGTTTACGAGGTAGCATTGTTGAAGACTTCTCTCACGTCC
TCACTCACGGAACTAACACACTGGATGACACCAGAGAAGGCGACAACTTC
CCTCACAACTGCGGCCTCCATCACCTGAACTAGTGCCCCACCCACTGGGT
GTCGTATTACTCATCTCCGCATGGCATAATCCTTTCTTGTCGTCTCTCGA
TCCACTCGTCGGGGCTATTGCAGCTGGTATGGCCTGGTTCTACCGCCACC
TGACTTGGCGCTCCCTCGTCATCGTTGTTTGCCGGCTCGGTTGGTGACCT
CACGCCTCCGTCCCCCCTTCGACGGGCGCGCGGCTACGCCCCGAGCGCCC
CAGCTCGCCGGCTGCGCGGTAGCTCCGGGCTCATTCCTCGCGTGGGTCTC
TCGAGCCGTCCGGCCGTCCCCGTCGTGCCTCCTCCCGCGCTCCGGGCCGC
GCTCCTATCCTCGTCTGGTCCGGGTTTGCTCAGGCGTGCGGATCGGCCCT
CGCTCCGCTGTCT
back to top