EY728224

Overview
NameEY728224
Unique NameEY728224
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length920
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY728224 vs. ExPASy Swiss-Prot
Match: VIN3_ARATH (Protein VERNALIZATION INSENSITIVE 3 OS=Arabidopsis thaliana GN=VIN3 PE=2 SV=2)

HSP 1 Score: 248.054 bits (632), Expect = 5.407e-65
Identity = 128/211 (60.66%), Postives = 154/211 (72.99%), Query Frame = 1
Query:   10 RRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKDTRRVDILCYRLSLGQKLLNGTEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSXPEVQKLCACAVESLDKMISNTILPNPSVQGSNVIGSNM-VKFENVRATSPTVVLGPENPS 639
            RRCSCCIC+K+DDNKDPSLWLTC        D+CG SCHLEC LK +R GIG D     LDG FYC  C K NDLLGCW+KQ+ VAK+TRRVD+LCYRLSLGQKLL GT KY+NL +++D+AVK LE +VGPL+G  +KM RGIVNRLSS   VQKLC+ A+E+LDK++S    P+ SV G    G  M V+ E ++A S TV +  E PS
Sbjct:  147 RRCSCCICQKFDDNKDPSLWLTC--------DACGSSCHLECGLKQDRYGIGSD----DLDGRFYCAYCGKDNDLLGCWRKQVKVAKETRRVDVLCYRLSLGQKLLRGTTKYRNLLELMDEAVKKLEGDVGPLSGWAMKMARGIVNRLSSGVHVQKLCSQAMEALDKVVS----PSESVSGQ---GDKMTVRVEEIQARSVTVRVDSEEPS 338          
The following BLAST results are available for this feature:
BLAST of EY728224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
VIN3_ARATH5.407e-6560.66Protein VERNALIZATION INSENSITIVE 3 OS=Arabidopsis... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (5 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-704-001-B01-CT.F Sweet orange fruit, development stadium (5 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY728224 ID=EY728224|Name=EY728224|organism=Citrus sinensis|type=EST|length=920bp
CCACGCGTCCGGAGATGTTCATGCTGCATCTGTCGTAAGTATGATGACAA
CAAGGATCCTAGTCTGTGGTTAACTTGCAGCTCAGAGCCTCCATTTGGAG
GTGATTCCTGTGGTATGTCATGTCATCTGGAGTGTGCATTGAAAAATGAA
AGATCTGGCATTGGAAAAGACAGATGCTATTCTGGACTTGATGGGAGCTT
CTATTGTATTTCATGTAGAAAAGTGAATGACTTACTCGGATGCTGGAAAA
AACAATTGGTGGTGGCAAAGGATACCAGACGAGTTGATATACTGTGTTAT
CGTCTCTCATTGGGCCAAAAACTTCTAAATGGGACTGAAAAGTACAAAAA
TCTCTCTAAGATTGTGGATGATGCTGTTAAAATGCTTGAAGATGAAGTGG
GTCCATTAACTGGTTTACCAGTAAAGATGGGAAGGGGTATAGTCAACAGA
CTTTCTTCANGACCAGAAGTTCAGAAACTCTGTGCTTGTGCCGTGGAGTC
ATTGGACAAAATGATTTCCAACACCATCTTGCCCAATCCTTCAGTACAAG
GATCAAATGTGATTGGTTCTAACATGGTTAAGTTTGAAAATGTTCGCGCA
ACATCCCCTACTGTGGTGTTGGGTCCCGAAAATCCTTCTCCAGGGAATAT
ATTAGTTTCCCTTTTTGGCATTCGGGGGCCCATGAGGGTTTTCCACCTAA
ACCTACTTGTACTCTCCTTGACCCAATACTAAGGTTGTTGAAACGGGACA
TTGCCGGTTACTGAGTATCAATCCAAATTGTTTCCCTTATGGTACAAACA
AGCTGGGAAGGTGAAAATTGGTTCTCACCGGCAGTCACGGATAAAATGAA
ACTGTCTCATAATTAAACAAGCCAACCCCGCCAAAACTTGACAACTCTTT
AATCATCTTCAGGGAAAGAA
back to top