FK826743

Overview
NameFK826743
Unique NameFK826743
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length251
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2871 contig Csv1_Contig2871:859..1109. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_ARATH (Phenylalanine ammonia-lyase 1 OS=Arabidopsis thaliana GN=PAL1 PE=1 SV=3)

HSP 1 Score: 93.9745 bits (232), Expect = 2.539e-19
Identity = 42/50 (84.00%), Postives = 46/50 (92.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            RFVRE LG+  LTGEKVTSPGEEFDKVFTA+C+GKIIDPM+ECL EWNGA
Sbjct:  671 RFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGA 720          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_ARATH (Phenylalanine ammonia-lyase 2 OS=Arabidopsis thaliana GN=PAL2 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.646e-18
Identity = 39/50 (78.00%), Postives = 46/50 (92.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            RFVRE LG+  LTGEKV SPGEEFDKVFTAMC+GK+IDP+++CL+EWNGA
Sbjct:  663 RFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGA 712          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_POPTR (Phenylalanine ammonia-lyase OS=Populus trichocarpa GN=PAL PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.150e-18
Identity = 42/50 (84.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGEKV SPGEEFDKVFTAMCQGKIIDPMLECL EWNG+
Sbjct:  661 KFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGS 710          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_CITLI (Phenylalanine ammonia-lyase OS=Citrus limon GN=PAL6 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.808e-18
Identity = 39/50 (78.00%), Postives = 46/50 (92.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            + VRE +G++ LTGEKV SPGEEFDKVFTAMC+GK+IDPMLECL+EWNGA
Sbjct:  666 KIVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGA 715          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_SOYBN (Phenylalanine ammonia-lyase 1 OS=Glycine max GN=PAL1 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.667e-18
Identity = 40/50 (80.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGEKV SPGEEFDK+FTAMCQGKIIDP++ECL EWNGA
Sbjct:  659 KFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGA 708          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL1_PHAVU (Phenylalanine ammonia-lyase class 1 (Fragment) OS=Phaseolus vulgaris PE=2 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 6.255e-18
Identity = 40/50 (80.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGEKV SPGEEFDK+FTA+CQGKIIDP+LECL EWNGA
Sbjct:  452 KFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGA 501          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_PERAE (Phenylalanine ammonia-lyase OS=Persea americana GN=PAL PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.067e-17
Identity = 39/50 (78.00%), Postives = 46/50 (92.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE L ++ LTGEKV SPGEEFDKVF+A+CQGK+IDP+LECLREWNGA
Sbjct:  566 KFVREELKTSLLTGEKVRSPGEEFDKVFSAICQGKVIDPLLECLREWNGA 615          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_PHAVU (Phenylalanine ammonia-lyase class 2 OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.820e-17
Identity = 40/50 (80.00%), Postives = 45/50 (90.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG++ LTGEKV SPGEE DKVF+AMCQGKIIDP+LECL EWNGA
Sbjct:  658 KFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGA 707          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PAL2_POPKI (Phenylalanine ammonia-lyase G2B OS=Populus kitakamiensis GN=PALG2B PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.377e-17
Identity = 38/50 (76.00%), Postives = 46/50 (92.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG++ LTGEKV SPGEEFDKVFTA+C GK+IDP+LECL+EW+GA
Sbjct:  656 KFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGA 705          
BLAST of FK826743 vs. ExPASy Swiss-Prot
Match: PALY_STYHU (Phenylalanine ammonia-lyase OS=Stylosanthes humilis GN=PAL17.1 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.104e-17
Identity = 39/50 (78.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query:    3 RFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 152
            +FVRE LG+  LTGEKV SPGEE DK+FTAMCQGKIIDP+LEC+ EWNGA
Sbjct:  661 KFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNGA 710          
The following BLAST results are available for this feature:
BLAST of FK826743 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
PAL1_ARATH2.539e-1984.00Phenylalanine ammonia-lyase 1 OS=Arabidopsis thali... [more]
PAL2_ARATH1.646e-1878.00Phenylalanine ammonia-lyase 2 OS=Arabidopsis thali... [more]
PALY_POPTR2.150e-1884.00Phenylalanine ammonia-lyase OS=Populus trichocarpa... [more]
PALY_CITLI2.808e-1878.00Phenylalanine ammonia-lyase OS=Citrus limon GN=PAL... [more]
PAL1_SOYBN3.667e-1880.00Phenylalanine ammonia-lyase 1 OS=Glycine max GN=PA... [more]
PAL1_PHAVU6.255e-1880.00Phenylalanine ammonia-lyase class 1 (Fragment) OS=... [more]
PALY_PERAE1.067e-1778.00Phenylalanine ammonia-lyase OS=Persea americana GN... [more]
PAL2_PHAVU1.820e-1780.00Phenylalanine ammonia-lyase class 2 OS=Phaseolus v... [more]
PAL2_POPKI2.377e-1776.00Phenylalanine ammonia-lyase G2B OS=Populus kitakam... [more]
PALY_STYHU3.104e-1778.00Phenylalanine ammonia-lyase OS=Stylosanthes humili... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone566 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 566, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826743 ID=FK826743|Name=FK826743|organism=Citrus sinensis|type=EST|length=251bp
ACAGGTTCGTGAGGGAGGGGCTCGGGTCTAATTTTCTAACAGGGGAAAAA
GTTACATCGCCCGGCGAGGAATTTGACAAAGTTTTTACCGCAATGTGCCA
GGGCAAGATCATTGATCCAATGCTGGAATGTCTCAGGGAATGGAATGGCG
CCCCTCTTCCAATTTGTTAGTTGTTTTTATTTTGTTTAATAACACGGTCT
TCAATCCCTTGTGTTCTTGTGTTCATAGAATTTGCCCATGCGAGTCAGTG
G
back to top