FK826730

Overview
NameFK826730
Unique NameFK826730
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length304
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2795 contig Csv1_Contig2795:471..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: CNGT1_ARATH (Cytokinin-N-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT76C1 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 5.537e-30
Identity = 56/95 (58.95%), Postives = 78/95 (82.11%), Query Frame = 3
Query:   12 PQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSDVWKVGLHLERKLERGEVERAIRRVMVDAEGREMRNRAAILKEKL 296
            PQ +VLAH ATG F TH GWNSTLES+CEGVPMIC PC  +Q V AR++S+VW+VG+HLE ++ER E+ERA+ R+MV+++G E+R R  +L++++
Sbjct:  339 PQLDVLAHRATGGFLTHNGWNSTLESICEGVPMICLPCKWDQFVNARFISEVWRVGIHLEGRIERREIERAVIRLMVESKGEEIRGRIKVLRDEV 433          
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: CNGT2_ARATH (Cytokinin-N-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT76C2 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.104e-29
Identity = 55/96 (57.29%), Postives = 79/96 (82.29%), Query Frame = 3
Query:   12 PQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSDVWKVGLHLERKLERGEVERAIRRVMVDAEGREMRNRAAILKEKLD 299
            PQQEVLAH ATG F TH GWNSTLES+CEGVPMIC P   +QM+ +R+VSD+WK+G+HLE ++E+ E+E+A+R +M ++EG ++R R  +LK++++
Sbjct:  332 PQQEVLAHRATGGFLTHNGWNSTLESICEGVPMICLPGGWDQMLNSRFVSDIWKIGIHLEGRIEKKEIEKAVRVLMEESEGNKIRERMKVLKDEVE 427          
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: COGT2_ARATH (Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT85A1 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.397e-19
Identity = 40/88 (45.45%), Postives = 59/88 (67.05%), Query Frame = 3
Query:   12 PQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSDVWKVGLHLERKLERGEVERAIRRVMVDAEGREMRNRA 275
            PQ++VL+HPA G F THCGWNS LES+  GVPM+C P   +Q +  ++  D W VG+ +   ++R EVE  +R +M   +G++MR +A
Sbjct:  365 PQEKVLSHPAIGGFLTHCGWNSILESLSCGVPMVCWPFFADQQMNCKFCCDEWDVGIEIGGDVKREEVEAVVRELMDGEKGKKMREKA 452          
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: HMNGT_SORBI (Cyanohydrin beta-glucosyltransferase OS=Sorghum bicolor GN=UGT85B1 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.349e-18
Identity = 42/89 (47.19%), Postives = 54/89 (60.67%), Query Frame = 3
Query:   12 PQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSDVWKVGLHLERKLERGEVERAIRRVMVDAEGREMRNRAA 278
            PQ  VL H A G F +HCGWNS LE+   G P++  PCHGEQ    R + +VW  G  L R++E G V R +R +MV   G+E R +AA
Sbjct:  370 PQAAVLKHAAVGLFVSHCGWNSLLEATAAGQPVLAWPCHGEQTTNCRQLCEVWGNGAQLPREVESGAVARLVREMMVGDLGKEKRAKAA 458          
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: UFOG7_MANES (Anthocyanidin 3-O-glucosyltransferase 7 (Fragment) OS=Manihot esculenta GN=GT7 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.151e-17
Identity = 41/95 (43.16%), Postives = 62/95 (65.26%), Query Frame = 3
Query:   12 PQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSDVWKVGLHLERKL--ERGEVERAIRRVMVDAEGREMRNRAAILKE 290
            PQ E+L H A G F THCGWNS LES+  GVPMIC+P  G+Q +  R V DVW++GL ++  +  + G ++  + ++++  +G++MR     LKE
Sbjct:  163 PQVEILEHAALGVFVTHCGWNSILESIVGGVPMICRPFFGDQRLNGRMVEDVWEIGLLMDGGVLTKNGAID-GLNQILLQGKGKKMRENIKRLKE 256          
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: UGFGT_ARATH (Flavonoid 3-O-glucosyltransferase OS=Arabidopsis thaliana GN=UGT78D2 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.375e-17
Identity = 42/94 (44.68%), Postives = 60/94 (63.83%), Query Frame = 3
Query:   12 PQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSDVWKVGLH-LERKLERGEVERAIRRVMVDAEGREMRNRAAILKE 290
            PQ E+L H ATG F THCGWNS LES+  GVPMIC+P  G+Q +  R V  VW++G+  +     +   E+ + +V+V  +G++M+  A  LKE
Sbjct:  340 PQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKDGFEKCLDKVLVQDDGKKMKCNAKKLKE 433          
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: UFOG_GENTR (Anthocyanidin 3-O-glucosyltransferase OS=Gentiana triflora PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 7.020e-17
Identity = 45/95 (47.37%), Postives = 59/95 (62.11%), Query Frame = 3
Query:   12 PQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSDVWKVGLHLERKL-ERGEVERAIRRVMVDAEGREMRNRAAILKEK 293
            PQ  VL +PA G F THCGWNSTLES+   VP+I +P  G+Q V AR V DVWK+G+ ++  +    E  R +  V+   +G+EMR     LKEK
Sbjct:  332 PQLHVLENPAIGVFVTHCGWNSTLESIFCRVPVIGRPFFGDQKVNARMVEDVWKIGVGVKGGVFTEDETTRVLELVLFSDKGKEMRQNVGRLKEK 426          
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: ZOX_PHAVU (Zeatin O-xylosyltransferase OS=Phaseolus vulgaris GN=ZOX1 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.197e-16
Identity = 46/101 (45.54%), Postives = 63/101 (62.38%), Query Frame = 3
Query:   12 PQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSDVWKVGLHL----ERK--LERGEVERAIRRVMVDAEGREMRNRAAILKEKL 296
            PQ E+L+H +TG F +HCGWNS LES+  GVPM     H +Q   A  V+DV KVGL +    +RK  +    +E A+RR+M   EG E+R RA  LK+++
Sbjct:  331 PQMEILSHSSTGGFMSHCGWNSCLESLTRGVPMATWAMHSDQPRNAVLVTDVLKVGLIVKDWEQRKSLVSASVIENAVRRLMETKEGDEIRKRAVKLKDEI 431          
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: UFOG5_MANES (Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot esculenta GN=GT5 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.564e-16
Identity = 42/99 (42.42%), Postives = 62/99 (62.63%), Query Frame = 3
Query:    9 TPQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSD-----VWKVGLHLERKLERGEVERAIRRVMVDAEGREMRNRAAILKE 290
            +PQ  +++HP+ G F +HCGWNS LES+  GVP+I  P + EQ + A  +++     V    L  +  ++R E+ER IRR+MVD EG E+R R   LK+
Sbjct:  352 SPQIHIMSHPSVGVFLSHCGWNSVLESITAGVPIIAWPIYAEQRMNATLLTEELGVAVRPKNLPAKEVVKREEIERMIRRIMVDEEGSEIRKRVRELKD 450          
BLAST of FK826730 vs. ExPASy Swiss-Prot
Match: ZOG_PHALU (Zeatin O-glucosyltransferase OS=Phaseolus lunatus GN=ZOG1 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.550e-16
Identity = 45/101 (44.55%), Postives = 60/101 (59.41%), Query Frame = 3
Query:   12 PQQEVLAHPATGAFWTHCGWNSTLESMCEGVPMICQPCHGEQMVIARYVSDVWKVGLHLERKLERGE------VERAIRRVMVDAEGREMRNRAAILKEKL 296
            PQ E+L+H +TG F +HCGWNS LES+  GVP+   P H +Q   A  V++V KVGL ++   +R        VE  +RR+M   EG EMR RA  LK  +
Sbjct:  336 PQLEILSHSSTGGFMSHCGWNSCLESITMGVPIATWPMHSDQPRNAVLVTEVLKVGLVVKDWAQRNSLVSASVVENGVRRLMETKEGDEMRQRAVRLKNAI 436          
The following BLAST results are available for this feature:
BLAST of FK826730 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
CNGT1_ARATH5.537e-3058.95Cytokinin-N-glucosyltransferase 1 OS=Arabidopsis t... [more]
CNGT2_ARATH2.104e-2957.29Cytokinin-N-glucosyltransferase 2 OS=Arabidopsis t... [more]
COGT2_ARATH4.397e-1945.45Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis t... [more]
HMNGT_SORBI6.349e-1847.19Cyanohydrin beta-glucosyltransferase OS=Sorghum bi... [more]
UFOG7_MANES3.151e-1743.16Anthocyanidin 3-O-glucosyltransferase 7 (Fragment)... [more]
UGFGT_ARATH5.375e-1744.68Flavonoid 3-O-glucosyltransferase OS=Arabidopsis t... [more]
UFOG_GENTR7.020e-1747.37Anthocyanidin 3-O-glucosyltransferase OS=Gentiana ... [more]
ZOX_PHAVU1.197e-1645.54Zeatin O-xylosyltransferase OS=Phaseolus vulgaris ... [more]
UFOG5_MANES1.564e-1642.42Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot... [more]
ZOG_PHALU4.550e-1644.55Zeatin O-glucosyltransferase OS=Phaseolus lunatus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionclone508 Citrus sinensis low-temperature inducible suppression subtractive hybridization (SSH) library Citrus sinensis cDNA clone 508, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FK826730 ID=FK826730|Name=FK826730|organism=Citrus sinensis|type=EST|length=304bp
ACGCGGGGACTCCCCAGCAAGAAGTGCTAGCTCATCCTGCCACCGGAGCA
TTTTGGACACATTGTGGCTGGAATTCGACGTTGGAAAGTATGTGTGAAGG
TGTCCCCATGATATGCCAGCCTTGTCATGGTGAGCAAATGGTGATTGCAA
GATATGTTAGTGATGTTTGGAAAGTTGGTTTGCATTTGGAAAGGAAGCTG
GAGAGAGGGGAGGTTGAAAGGGCAATTAGACGAGTAATGGTGGATGCCGA
GGGGCGGGAAATGAGGAACAGAGCTGCGATTCTGAAGGAAAAACTGGATC
TTTG
back to top