FK826692
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2) HSP 1 Score: 75.8702 bits (185), Expect = 7.299e-14 Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = -2 Query: 1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117 LSGVILFEETLYQKT GKPFVDVLKEGGVLPGIKVDKG Sbjct: 69 LSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKG 107
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.299e-14 Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = -2 Query: 1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117 LSGVILFEETLYQKTAAGKPFVDVL E GVLPGIKVDKG Sbjct: 70 LSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKG 108
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.245e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = -2 Query: 1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117 +SGVILFEETLYQKT GKPFVDVLKEGGVLPGIKVDKG Sbjct: 69 ISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKG 107
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.124e-13 Identity = 35/39 (89.74%), Postives = 37/39 (94.87%), Query Frame = -2 Query: 1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117 LSGVILFEETLYQKTA GKPFVD +K+GGVLPGIKVDKG Sbjct: 69 LSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKG 107
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.774e-13 Identity = 36/39 (92.31%), Postives = 36/39 (92.31%), Query Frame = -2 Query: 1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117 LSGVILFEETLYQ TAAGKPFVDVL E GVLPGIKVDKG Sbjct: 69 LSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKG 107
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 4.005e-12 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = -2 Query: 1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117 LSGVILFEETLYQKT+ GKPFVD+L E GV+PGIKVDKG Sbjct: 69 LSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKG 107
BLAST of FK826692 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.428e-11 Identity = 30/39 (76.92%), Postives = 36/39 (92.31%), Query Frame = -2 Query: 1 LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKG 117 LSGVILFEETLYQK++ GKPFV++L+E V+PGIKVDKG Sbjct: 69 LSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKG 107 The following BLAST results are available for this feature:
BLAST of FK826692 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 7
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FK826692 ID=FK826692; Name=FK826692; organism=Citrus sinensis; type=EST; length=118bpback to top |