FE659129
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE659129 vs. ExPASy Swiss-Prot
Match: RL223_ARATH (60S ribosomal protein L22-3 OS=Arabidopsis thaliana GN=RPL22C PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.611e-13 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = -2 Query: 130 LTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIA 234 LTKKYLKKHNVRDWLRVIA+NKDRN+YELRYFNIA Sbjct: 82 LTKKYLKKHNVRDWLRVIAANKDRNLYELRYFNIA 116
BLAST of FE659129 vs. ExPASy Swiss-Prot
Match: RL222_ARATH (60S ribosomal protein L22-2 OS=Arabidopsis thaliana GN=RPL22B PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.611e-13 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = -2 Query: 130 LTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIA 234 LTKKYLKKHNVRDWLRVIA+NKDRN+YELRYFNIA Sbjct: 82 LTKKYLKKHNVRDWLRVIAANKDRNLYELRYFNIA 116
BLAST of FE659129 vs. ExPASy Swiss-Prot
Match: RL221_ARATH (Putative 60S ribosomal protein L22-1 OS=Arabidopsis thaliana GN=RPL22A PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.765e-11 Identity = 29/34 (85.29%), Postives = 33/34 (97.06%), Query Frame = -2 Query: 133 LTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNI 234 LTKKYLKK+N+RDWLRVIASNKD+NVYE+RYF I Sbjct: 84 LTKKYLKKYNLRDWLRVIASNKDKNVYEVRYFRI 117 The following BLAST results are available for this feature:
BLAST of FE659129 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE659129 ID=FE659129; Name=FE659129; organism=Citrus sinensis; type=EST; length=235bpback to top |