FE659077

Overview
NameFE659077
Unique NameFE659077
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length301
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8399 contig Csv1_Contig8399:405..705. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FE659077 vs. ExPASy Swiss-Prot
Match: SKI32_ARATH (F-box protein 7 OS=Arabidopsis thaliana GN=SKIP32 PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.659e-42
Identity = 78/102 (76.47%), Postives = 94/102 (92.16%), Query Frame = -2
Query:    1 EGSWRKMWLLRPRIRIDGLYVSRSTYIRAGVAEWKITNPVHIVCYYRYMRFFPSGRFIYKNSSQKIKDVAKIMNFRAAKADCVFTGHYTL--SEDKVEAAVL 300
            +GSWRKMWLLR R+R DGLYVSR+TYIRAG+AEWKITNPVHIVCYYRY+RF+PSGRF+YKNSSQK+KDVAK MNF+A+K++ ++ G YTL  S+DK+EAAVL
Sbjct:  124 DGSWRKMWLLRSRVRTDGLYVSRNTYIRAGIAEWKITNPVHIVCYYRYIRFYPSGRFLYKNSSQKLKDVAKYMNFKASKSENLYKGTYTLSMSDDKIEAAVL 225          
BLAST of FE659077 vs. ExPASy Swiss-Prot
Match: FBX9_MOUSE (F-box only protein 9 OS=Mus musculus GN=Fbxo9 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 5.031e-15
Identity = 38/92 (41.30%), Postives = 54/92 (58.70%), Query Frame = -2
Query:   22 SWRKMWLLRPRIRIDGLYVSRSTYIRAGVAEWK-ITNPVHIVCYYRYMRFFPSGRFIYKNSSQKIKDVAKIMNFRAAKADCVFTGHYTLSED 294
            SWR+M+L RPR+R DG+Y+S++TYIR G           H V YYRYMRFFP G  +   + ++   +   +  R  + D +  GHY LS+D
Sbjct:  243 SWREMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYMRFFPDGHVMMLTTPEEPPSIVPRLRTRNTRTDAILLGHYRLSQD 334          
BLAST of FE659077 vs. ExPASy Swiss-Prot
Match: FBX9_HUMAN (F-box only protein 9 OS=Homo sapiens GN=FBXO9 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.582e-15
Identity = 37/92 (40.22%), Postives = 55/92 (59.78%), Query Frame = -2
Query:   22 SWRKMWLLRPRIRIDGLYVSRSTYIRAGVAEWK-ITNPVHIVCYYRYMRFFPSGRFIYKNSSQKIKDVAKIMNFRAAKADCVFTGHYTLSED 294
            SWR+M+L RPR+R DG+Y+S++TYIR G           H V YYRY+RFFP G  +   + ++ + +   +  R  + D +  GHY LS+D
Sbjct:  253 SWREMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYIRFFPDGHVMMLTTPEEPQSIVPRLRTRNTRTDAILLGHYRLSQD 344          
BLAST of FE659077 vs. ExPASy Swiss-Prot
Match: FBX9_BOVIN (F-box only protein 9 OS=Bos taurus GN=FBXO9 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.582e-15
Identity = 37/92 (40.22%), Postives = 55/92 (59.78%), Query Frame = -2
Query:   22 SWRKMWLLRPRIRIDGLYVSRSTYIRAGVAEWK-ITNPVHIVCYYRYMRFFPSGRFIYKNSSQKIKDVAKIMNFRAAKADCVFTGHYTLSED 294
            SWR+M+L RPR+R DG+Y+S++TYIR G           H V YYRY+RFFP G  +   + ++ + +   +  R  + D +  GHY LS+D
Sbjct:  243 SWREMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYVRFFPDGHVMMLTTPEEPQSIVPRLRTRNTRTDAILLGHYRLSQD 334          
BLAST of FE659077 vs. ExPASy Swiss-Prot
Match: FBX9_RAT (F-box only protein 9 OS=Rattus norvegicus GN=Fbxo9 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.464e-14
Identity = 37/92 (40.22%), Postives = 54/92 (58.70%), Query Frame = -2
Query:   22 SWRKMWLLRPRIRIDGLYVSRSTYIRAGVAEWK-ITNPVHIVCYYRYMRFFPSGRFIYKNSSQKIKDVAKIMNFRAAKADCVFTGHYTLSED 294
            SWR+M+L RPR+R DG+Y+S++TYIR G           H V YYRY+RFFP G  +   + ++   +   +  R  + D +  GHY LS+D
Sbjct:  241 SWREMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYIRFFPDGHVMMLTTPEEPPSIVPRLRTRNTRTDAILLGHYRLSQD 332          
The following BLAST results are available for this feature:
BLAST of FE659077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
SKI32_ARATH1.659e-4276.47F-box protein 7 OS=Arabidopsis thaliana GN=SKIP32 ... [more]
FBX9_MOUSE5.031e-1541.30F-box only protein 9 OS=Mus musculus GN=Fbxo9 PE=2... [more]
FBX9_HUMAN8.582e-1540.22F-box only protein 9 OS=Homo sapiens GN=FBXO9 PE=2... [more]
FBX9_BOVIN8.582e-1540.22F-box only protein 9 OS=Bos taurus GN=FBXO9 PE=2 S... [more]
FBX9_RAT1.464e-1440.22F-box only protein 9 OS=Rattus norvegicus GN=Fbxo9... [more]
back to top
Libraries
Library NameType
Hong Anliu sweet orange SSH librarycdna_library
Properties
Property NameValue
Genbank descriptionC16 Hong Anliu sweet orange SSH library Citrus sinensis cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FE659077 ID=FE659077|Name=FE659077|organism=Citrus sinensis|type=EST|length=301bp
CAGAACAGCAGCTTCCACCTTGTCCTCTGACAATGTATAATGGCCGGTAA
ATACACAGTCTGCTTTAGCTGCACGAAAGTTCATGATTTTTGCCACATCT
TTGATCTTTTGAGAAGAATTCTTGTAAATAAATCTGCCAGAAGGGAAAAA
TCTCATGTATCGGTAGTAGCAGACTATGTGGACAGGGTTGGTAATCTTCC
ACTCAGCAACTCCGGCTCGGATATAGGTGCTCCTACTCACATAAAGACCA
TCAATGCGGATCCTAGGTCTTAAAAGCCACATTTTCCTCCAAGAACCCTC
G
back to top