EY692685
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY692685 vs. ExPASy Swiss-Prot
Match: PAO_ARATH (Pheophorbide a oxygenase, chloroplastic OS=Arabidopsis thaliana GN=PAO PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 6.151e-11 Identity = 31/88 (35.23%), Postives = 49/88 (55.68%), Query Frame = 1 Query: 352 ADYDWTEEWYPLYLTKDVPDDAPLGLTVFDQQIVLYKDGKGE-LRCHQDRCPHMLAKLSDGQLIDS-KLECLYHGWQFESEGKCXNIP 609 +++ W + WYP+ L +D+ + P + + +VL+ D + D CPH LA LS+G+L ++ L+C YHGW F G C IP Sbjct: 80 SEFKWRDHWYPVSLVEDLDPNVPTPFQLLGRDLVLWFDRNDQKWAAFDDLCPHRLAPLSEGRLDENGHLQCSYHGWSFGGCGSCTRIP 167
BLAST of EY692685 vs. ExPASy Swiss-Prot
Match: CAO_CHLRE (Chlorophyllide a oxygenase, chloroplastic OS=Chlamydomonas reinhardtii GN=CAO PE=2 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 8.034e-11 Identity = 26/78 (33.33%), Postives = 45/78 (57.69%), Query Frame = 1 Query: 376 WYPLYLTKDVPDDAPLGLTVFDQQIVLYKDGKGELRCHQDRCPHMLAKLSDGQLIDSKLECLYHGWQFESEGKCXNIP 609 WYP + +P D + +F + V+++D KG+ C +D C H LS G++++ ++ C YHGW+F +G C +P Sbjct: 305 WYPAEFSARLPKDTLVPFELFGEPWVMFRDEKGQPSCIRDECAHRGCPLSLGKVVEGQVMCPYHGWEFNGDGACTKMP 382 The following BLAST results are available for this feature:
BLAST of EY692685 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY692685 ID=EY692685; Name=EY692685; organism=Citrus sinensis; type=EST; length=945bpback to top |