EY692328

Overview
NameEY692328
Unique NameEY692328
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1007
Libraries
Library NameType
Sweet orange bark, greenhouse plantcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY692328 vs. ExPASy Swiss-Prot
Match: VILI1_ARATH (Villin-1 OS=Arabidopsis thaliana GN=VLN1 PE=2 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 3.828e-22
Identity = 62/145 (42.76%), Postives = 80/145 (55.17%), Query Frame = 3
Query:   12 AVSSHGLQXXXXXXXXXXXXKLNSA-DRHRAFCETPTAQRLFSESTLDKDXXXXXXXXXXXXXXV------IQFNESEAGVSSLIYSYEQLRVDSRNPVIGIDVTKREAYLSEEEFQEKFKMTKRAFYELPKWKQNKFKMSLHLF 425
            +VSS+G +             L+SA D   +   TP  ++LFSES L                 +      +  N   + + SL YSYEQLRVDS+ PV  ID T+REAYL+E+EF+E+F M K  FY LPKWKQNK K+SLHLF
Sbjct:  765 SVSSNGSERGVSPCSSEKLLSLSSAEDMTNSSNSTPVVKKLFSESLLVDPNDGVARQESSSKSDISKQKPRVGINSDLSSLESLAYSYEQLRVDSQKPVTDIDATRREAYLTEKEFEERFGMAKSEFYALPKWKQNKLKISLHLF 909          
BLAST of EY692328 vs. ExPASy Swiss-Prot
Match: VILI4_ARATH (Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.324e-17
Identity = 40/60 (66.67%), Postives = 50/60 (83.33%), Query Frame = 3
Query:  246 YSYEQLRVDSRNPVIGIDVTKREAYLSEEEFQEKFKMTKRAFYELPKWKQNKFKMSLHLF 425
            + Y++L+  S +PV  IDVT+REAYLS EEF+EKF MTK AFY+LPKWKQNKFKM++ LF
Sbjct:  915 HPYDRLKTTSTDPVSDIDVTRREAYLSSEEFKEKFGMTKEAFYKLPKWKQNKFKMAVQLF 974          
BLAST of EY692328 vs. ExPASy Swiss-Prot
Match: VILI2_ARATH (Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 1.458e-13
Identity = 38/70 (54.29%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  216 ESEAGVSSLIYSYEQLRVDSRNPVIGIDVTKREAYLSEEEFQEKFKMTKRAFYELPKWKQNKFKMSLHLF 425
            +SE   S   ++YEQLR  S NPV GID  +REAYLSEEEFQ  F + K AF  LP+WKQ+  K    LF
Sbjct:  907 DSEIQPSGATFTYEQLRAKSENPVTGIDFKRREAYLSEEEFQSVFGIEKEAFNNLPRWKQDLLKKKFDLF 976          
BLAST of EY692328 vs. ExPASy Swiss-Prot
Match: VILI3_ARATH (Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.125e-12
Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 3
Query:  213 NESEAGVSSLIYSYEQLRVDSRNPVIGIDVTKREAYLSEEEFQEKFKMTKRAFYELPKWKQNKFKMSLHLF 425
            ++SE   + + ++YE+L+  S  PV GID  +REAYLSE EF+  F M K +FY+LP WKQ+  K   +LF
Sbjct:  896 DDSEVETTGVTFTYERLQAKSEKPVTGIDFKRREAYLSEVEFKTVFGMEKESFYKLPGWKQDLLKKKFNLF 966          
The following BLAST results are available for this feature:
BLAST of EY692328 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
VILI1_ARATH3.828e-2242.76Villin-1 OS=Arabidopsis thaliana GN=VLN1 PE=2 SV=2[more]
VILI4_ARATH6.324e-1766.67Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1[more]
VILI2_ARATH1.458e-1354.29Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2[more]
VILI3_ARATH6.125e-1246.48Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C2-003-059-B07-CT.F Sweet orange bark, greenhouse plant Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY692328 ID=EY692328; Name=EY692328; organism=Citrus sinensis; type=EST; length=1007bp
CGGACGCGTGGGCCGTCAGTTCACATGGTTTGCAAGGTAGTGGGAGTCCT
ATACCAAGCATATCAAGTTCAAAATTGAACTCTGCAGATAGACACAGAGC
ATTCTGTGAAACTCCAACAGCCCAGCGGCTCTTTTCAGAATCGACTCTTG
ATAAAGATTCTCCGACTGGAGAGCCAAGCTCCTCTTCTAAGAGCACTAAG
GTAATTCAGTTTAATGAAAGTGAAGCTGGGGTAAGCTCATTGATATATTC
ATACGAACAATTGCGAGTAGATTCAAGGAACCCTGTGATAGGCATAGATG
TGACCAAAAGAGAGGCATATTTATCTGAGGAGGAATTTCAAGAAAAATTC
AAAATGACTAAAAGAGCCTTTTATGAGCTTCCCAAATGGAAACAGAACAA
GTTCAAGATGTCTCTTCATCTTTTTTAGAGCACGTCACCTTGAGGTTAGA
GGCAGTCAGGCTCCGGCGAATGAATAGGTTAGGTAAATGTCTCCCCTTTA
AACCTAGTCCATGGTTTGAACTCAGTCGCTATCCAGATTAGTTTTTTACT
AGAGCAGTCTTTGAGTGAGGAGCACTTATTCTAACACTTCATTTTCTATA
TTTATTTTTATGAAGTCTGTTTTAACAATTCTGAATTGAGTGAATATTGA
GTGTGGGTATGTAAATAGAGAAGAGTCTGTGACGGGACGCAATTGAACCC
TTGCGGCGGCACCATTAAAACTTTTGCATTCTTTCCTGAATCCGAATTTC
TTCCAAAACCTTAAAAAAAAAAAAAAAAGGGGGGGCCGCCCTAAAGGGAA
CCAAGTTTACGTACGCCGGGGTTGGGAACGTCCTTAACTCTTCCTAAAGG
GGCCCCCTAAATTTCAAATTCCCTGGGCCCGGCCTTTTTTACAACGGCCC
GGGACTGGGGAGAAAANCCCTGGGGGGTTTCCCCCCAATTTTTATTCCCC
CCTTTGGGGCCACCAAATTCCCCCCCCTTTTTTCCCCCCGGGTCGGGGGG
GGGAAAA
back to top