EY691805
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY691805 vs. ExPASy Swiss-Prot
Match: CRD1_GOSHI (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Gossypium hirsutum GN=CRD1 PE=2 SV=2) HSP 1 Score: 79.7221 bits (195), Expect = 4.972e-15 Identity = 38/45 (84.44%), Postives = 43/45 (95.56%), Query Frame = 3 Query: 69 LDLLMNLKRIPLIAALASELLATYLMPPVDSGSVDFAEFEPELVY 203 + L+ NLKRIPLIAALASELLATYLMPP++SGSVDFAEFEP+LVY Sbjct: 361 IPLVKNLKRIPLIAALASELLATYLMPPIESGSVDFAEFEPQLVY 405
BLAST of EY691805 vs. ExPASy Swiss-Prot
Match: CRD1_HORVU (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Hordeum vulgare GN=CRD1 PE=1 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.653e-13 Identity = 33/57 (57.89%), Postives = 45/57 (78.95%), Query Frame = 3 Query: 33 DIRVDHASDQLTLDLLMNLKRIPLIAALASELLATYLMPPVDSGSVDFAEFEPELVY 203 ++++ + L L+ NLKR+PLIA L SE++A YLMPP++SGSVDFAEFEP+LVY Sbjct: 361 NLKIISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 417
BLAST of EY691805 vs. ExPASy Swiss-Prot
Match: CRD1_EUPES (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Euphorbia esula GN=CRD1 PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.653e-13 Identity = 33/43 (76.74%), Postives = 40/43 (93.02%), Query Frame = 3 Query: 75 LLMNLKRIPLIAALASELLATYLMPPVDSGSVDFAEFEPELVY 203 ++ NLKR+PLIAAL SE+LA YLMPP++SGSVDFAEFEP+LVY Sbjct: 363 VVKNLKRVPLIAALVSEILAAYLMPPIESGSVDFAEFEPKLVY 405
BLAST of EY691805 vs. ExPASy Swiss-Prot
Match: CRD1_ARATH (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Arabidopsis thaliana GN=CRD1 PE=2 SV=2) HSP 1 Score: 69.707 bits (169), Expect = 5.145e-12 Identity = 32/42 (76.19%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 78 LMNLKRIPLIAALASELLATYLMPPVDSGSVDFAEFEPELVY 203 + LKRIPL+ +LASE+LA YLMPPV+SGSVDFAEFEP LVY Sbjct: 368 IKTLKRIPLVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409 The following BLAST results are available for this feature:
BLAST of EY691805 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY691805 ID=EY691805; Name=EY691805; organism=Citrus sinensis; type=EST; length=396bpback to top |