EY660159

Overview
NameEY660159
Unique NameEY660159
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length876
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: MPPA_SOLTU (Mitochondrial-processing peptidase subunit alpha OS=Solanum tuberosum GN=MPP PE=1 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 1.394e-115
Identity = 204/275 (74.18%), Postives = 235/275 (85.45%), Query Frame = 2
Query:   14 KTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLLSDLPSIHPREEPKSVYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGRSGSFSAGGPGK 838
            KT+I+TL NG+K+ASE SV+P ASI LYV CGSIYE+P S+G THLLERMAF+ST NRSHLRIVRE+EAIGGNV ASASRE M Y++DALKTYVP+MVE+L DCVRNP FLDWEV EQL KVK+EISE S NPQ LLLEA+HSAGY+G   N L+A E+ INRLNST+LEEFVAENYT PRMVLAASGVEH++ + VAEPLLSDLP +   EEPK VY GGDYRCQAD+  ++THF LAFE+PGGW  +K++MTLTVLQML+G  GSFSAGGPGK
Sbjct:   74 KTQITTLANGLKVASEASVNPAASIGLYVDCGSIYETPASYGATHLLERMAFKSTLNRSHLRIVREIEAIGGNVTASASREHMIYTYDALKTYVPQMVEMLADCVRNPAFLDWEVKEQLEKVKAEISEYSKNPQHLLLEAVHSAGYAGPYGNSLMATEATINRLNSTVLEEFVAENYTAPRMVLAASGVEHEEFLKVAEPLLSDLPKVATIEEPKPVYVGGDYRCQADA--EMTHFALAFEVPGGWMSEKESMTLTVLQMLMGGGGSFSAGGPGK 346          
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: MPPA1_ARATH (Probable mitochondrial-processing peptidase subunit alpha-1 OS=Arabidopsis thaliana GN=At1g51980 PE=1 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.446e-104
Identity = 188/275 (68.36%), Postives = 226/275 (82.18%), Query Frame = 2
Query:   14 KTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLLSDLPSIHPREEPKSVYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGRSGSFSAGGPGK 838
            K +I+TLPNG+KIASET+ +P ASI LYV CGSIYE+P   G THLLERMAF+ST NR+H R+VRE+EAIGGN  ASASREQM Y+ DALKTYVPEMVE+LID VRNP FLDWEVNE+L K+K EI+E++ NP   LLEAIHSAGYSG LA+PL APESA++RLN  LLEEF+ EN+T  RMVLAASGVEH++L+ VAEPL SDLP++ P+  PKS Y GGD+R    +G + THF +AFE+P GW+ +K+A+T TVLQML+G  GSFSAGGPGK
Sbjct:   77 KLQITTLPNGLKIASETTPNPAASIGLYVDCGSIYEAPYFHGATHLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLIDSVRNPAFLDWEVNEELRKMKVEIAELAKNPMGFLLEAIHSAGYSGPLASPLYAPESALDRLNGELLEEFMTENFTAARMVLAASGVEHEELLKVAEPLTSDLPNVPPQLAPKSQYVGGDFR--QHTGGEATHFAVAFEVP-GWNNEKEAVTATVLQMLMGGGGSFSAGGPGK 348          
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: MPPA2_ARATH (Probable mitochondrial-processing peptidase subunit alpha-2 OS=Arabidopsis thaliana GN=At3g16480 PE=1 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 6.717e-102
Identity = 188/275 (68.36%), Postives = 217/275 (78.91%), Query Frame = 2
Query:   14 KTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLLSDLPSIHPREEPKSVYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGRSGSFSAGGPGK 838
            K K +TLPNG+ IA+E S +P ASI LYV CGSIYE+P   G THLLERMAF+ST NRSH R+VRE+EAIGGN  ASASREQMGY+ DALKTYVPEMVE+LID VRNP FLDWEVNE+L KVK EI E + NP   LLEA+HSAGYSGALANPL APESAI  L   +LE FV ENYT  RMVLAASGV+H++L+ V EPLLSDLP++    EPKS Y GGD+R    +G + THF LAFE+P GW+ +K+A+  TVLQML+G  GSFSAGGPGK
Sbjct:   73 KLKTTTLPNGLTIATEMSPNPAASIGLYVDCGSIYETPQFRGATHLLERMAFKSTLNRSHFRLVREIEAIGGNTSASASREQMGYTIDALKTYVPEMVEVLIDSVRNPAFLDWEVNEELRKVKVEIGEFATNPMGFLLEAVHSAGYSGALANPLYAPESAITGLTGEVLENFVFENYTASRMVLAASGVDHEELLKVVEPLLSDLPNVPRPAEPKSQYVGGDFR--QHTGGEATHFALAFEVP-GWNNEKEAIIATVLQMLMGGGGSFSAGGPGK 344          
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: MPPA_YEAST (Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae GN=MAS2 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.290e-36
Identity = 98/280 (35.00%), Postives = 148/280 (52.86%), Query Frame = 2
Query:   20 KISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSG-ALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLLSDLPSIHPREEPK-SVYTGGDYRCQADSG-----DQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGRSGSFSAGGPGK 838
            K+S+L NG+K+A+  +    +++ LY+  GS +E     G TH+L+R+AF+ST +     +   +E +GGN Q ++SRE + Y        V +M++L+ + VR P   + E+ EQ    + EI EV   P+ +L E +H+A YSG  L +PL+ P   I  ++   L ++  + YT    V A  GV H++ + + E  L D  S HP    K + YTGG+  C   +       +L H  + FE  G      D   L  LQ LLG  GSFSAGGPGK
Sbjct:   20 KLSSLANGLKVATSNTPGHFSALGLYIDAGSRFEGRNLKGCTHILDRLAFKSTEHVEGRAMAETLELLGGNYQCTSSRENLMYQASVFNQDVGKMLQLMSETVRFPKITEQELQEQKLSAEYEIDEVWMKPELVLPELLHTAAYSGETLGSPLICPRELIPSISKYYLLDYRNKFYTPENTVAAFVGVPHEKALELTEKYLGDWQSTHPPITKKVAQYTGGE-SCIPPAPVFGNLPELFHIQIGFE--GLPIDHPDIYALATLQTLLGGGGSFSAGGPGK 296          
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: QCR2_HUMAN (Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens GN=UQCRC2 PE=1 SV=3)

HSP 1 Score: 152.91 bits (385), Expect = 2.201e-36
Identity = 94/261 (36.02%), Postives = 141/261 (54.02%), Query Frame = 2
Query:   20 KISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLLSDLPSIHPREEPKSVYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLG 802
            + + LPNG+ IAS  + SPV+ I L++  GS YE   + GTTHLL   +  +T+  S  +I R +EA+GG +  +A+RE M Y+ + L+  V  ++E L++    P F  WEV +   ++K + +    NPQ+ ++E +H+A Y  ALANPL  P+  I ++ S  L  FV  ++T  RM L   GV H  L  VAE  L+    +      K+ Y GG+ R Q  +GD L H   AF          +A   +VLQ +LG
Sbjct:   39 EFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGL-GLSGAKANYRGGEIREQ--NGDSLVH--AAFVAESAVAGSAEANAFSVLQHVLG 294          
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: QCR1_MOUSE (Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus GN=Uqcrc1 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 9.248e-35
Identity = 89/278 (32.01%), Postives = 153/278 (55.04%), Query Frame = 2
Query:   14 KTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGA-LANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAAS-GVEHDQLVSVAEPLLSDLPSIHPREEPKSV----YTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGRSGSFSAGG 829
            +T++S L NG+++ASE S     ++ +++  GS YE+  + G  + LE +AF+ T+NR    + +EVE+IG ++ A ++RE   Y   AL   +P++VELL D V+N    D ++ ++   +  E+ E   + Q+++ + +H+  + G  LA  +  P   + RL+ T L +++  NY  PRMVLAA+ GVEH QL+ +A+  LS +  ++  +    +    +TG + R   D    L H  +A E P GW  + D +TL V   ++G       GG
Sbjct:   47 ETQVSILDNGLRVASEQSSHATCTVGVWIDAGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHLNAYSTREHTAYLIKALSKDLPKVVELLADIVQNSSLEDSQIEKERDVILREMQENDASMQNVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLNRNYKAPRMVLAAAGGVEHQQLLDLAQKHLSSVSRVYEEDAVPGLTPCRFTGSEIR-HRDDALPLAHVAIAVEGP-GW-ANPDNVTLQVANAIIGHYDCTCGGG 321          
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: QCR2_RAT (Cytochrome b-c1 complex subunit 2, mitochondrial OS=Rattus norvegicus GN=Uqcrc2 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 1.208e-34
Identity = 88/269 (32.71%), Postives = 142/269 (52.79%), Query Frame = 2
Query:   20 KISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLLSDLPSIHPREEPKSVYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGRSGSFSAG 826
            + + LPNG+ IAS  + +P++ I L++  GS YE+    GT+HLL   +  +T+  S  +I R +EA+GG +  +A+RE M Y+ + ++  +  ++E L++    P F  WEV    +++K + +    NPQ+ ++E +H   Y  ALANPL  P+  + ++ S  L  FV  ++T  RM L   GV H  L  VAE  L+    +      K+ Y GG+ R Q  +GD L H  +  E     + + +A   +VLQ LLG       G
Sbjct:   38 EFTKLPNGLVIASLENYAPLSRIGLFIKAGSRYENYNYLGTSHLLRLASTLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVEGIRDDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNPQTRIIENLHDVAYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSILKEVAEQFLNIRGGL-GLAGAKAKYRGGEIREQ--NGDNLVHAAIVAESAAIGNAEANA--FSVLQHLLGAGPHIKRG 301          
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: QCR2_MOUSE (Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus GN=Uqcrc2 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.208e-34
Identity = 88/269 (32.71%), Postives = 142/269 (52.79%), Query Frame = 2
Query:   20 KISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLLSDLPSIHPREEPKSVYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGRSGSFSAG 826
            + + LPNG+ IAS  + +P++ I L+V  GS YE   + GT+HLL   +  +T+  S  +I R +EA+GG +  +A+RE M Y+ + +++ +  ++E L++    P F  WEV    +++K + +    N Q+ ++E +H   Y  ALANPL  P+  + ++ S  L  FV  ++T  RM L   GV H  L  VAE  L+    +      K+ Y GG+ R Q  +GD L H  +  E     + + +A   +VLQ LLG       G
Sbjct:   39 EFTKLPNGLVIASLENYAPLSRIGLFVKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVEGIRSDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNSQTRIIENLHDVAYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSVLKQVAEQFLNMRGGL-GLAGAKAKYRGGEIREQ--NGDNLVHAAIVAESAAIGNAEANA--FSVLQHLLGAGPHIKRG 302          
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: QCR1_RAT (Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus GN=Uqcrc1 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.060e-34
Identity = 87/278 (31.29%), Postives = 154/278 (55.40%), Query Frame = 2
Query:   14 KTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGA-LANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAAS-GVEHDQLVSVAEPLLSDLPSIHPREEPKSV----YTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGRSGSFSAGG 829
            +T++S L NG+++ASE S  P  ++ +++  GS YE+  + G  + LE +AF+ T+NR    + +EVE+IG ++ A ++RE   Y   AL   +P++VELL D V+N    D ++ ++   +  E+ E   + Q+++ + +H+  + G  LA  +  P   + RL+ T L ++++ +Y  PRMVLAA+ GV+H QL+ +A+   S +  ++  +   S+    +TG + R   D    L H  +A E P GW  + D + L V   ++G       GG
Sbjct:   47 ETQVSVLDNGLRVASEQSSHPTCTVGVWIDVGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHLNAYSTREHTAYLIKALSKDLPKVVELLADIVQNISLEDSQIEKERDVILREMQENDASMQNVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLSRHYKAPRMVLAAAGGVKHQQLLDLAQDHFSSVSQVYEEDAVPSITPCRFTGSEIR-HRDDALPLAHVAIAVEGP-GW-ANPDNVALQVANAIIGHYDCTYGGG 321          
BLAST of EY660159 vs. ExPASy Swiss-Prot
Match: MPPB_BOVIN (Mitochondrial-processing peptidase subunit beta OS=Bos taurus GN=PMPCB PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.060e-34
Identity = 91/277 (32.85%), Postives = 144/277 (51.99%), Query Frame = 2
Query:   14 KTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSG-ALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAAS-GVEHDQLVSVAEPLLSDLPSIHPRE---EPKSVYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGRSGSFSAGG 829
            +T+++ L NG+++ASE S     ++ L++  GS YE+  + GT H LE MAF+ T+ RS L +  E+E +G ++ A  SREQ  Y   A    +P  VE+L D ++N    + E+  +   +  E+ EV  N Q ++ + +H+  Y   AL   +L P   I  +N   L +++  +Y GPR+VLAA+ GV HD+L+ +A+    +  S H  E    P   +TG + R + D    L H  +A E  G  H   D + L V   L+G       GG
Sbjct:   58 ETRVTCLENGLRVASEDSGLATCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLDLELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPRIVLAAAGGVSHDELLELAKFHFGESLSTHKGEIPALPPCKFTGSEIRVR-DDKMPLAHLAVAVEAVGWAH--PDTICLMVANTLIGNWDRSFGGG 331          
The following BLAST results are available for this feature:
BLAST of EY660159 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 53
Match NameE-valueIdentityDescription
MPPA_SOLTU1.394e-11574.18Mitochondrial-processing peptidase subunit alpha O... [more]
MPPA1_ARATH1.446e-10468.36Probable mitochondrial-processing peptidase subuni... [more]
MPPA2_ARATH6.717e-10268.36Probable mitochondrial-processing peptidase subuni... [more]
MPPA_YEAST1.290e-3635.00Mitochondrial-processing peptidase subunit alpha O... [more]
QCR2_HUMAN2.201e-3636.02Cytochrome b-c1 complex subunit 2, mitochondrial O... [more]
QCR1_MOUSE9.248e-3532.01Cytochrome b-c1 complex subunit 1, mitochondrial O... [more]
QCR2_RAT1.208e-3432.71Cytochrome b-c1 complex subunit 2, mitochondrial O... [more]
QCR2_MOUSE1.208e-3432.71Cytochrome b-c1 complex subunit 2, mitochondrial O... [more]
QCR1_RAT2.060e-3431.29Cytochrome b-c1 complex subunit 1, mitochondrial O... [more]
MPPB_BOVIN2.060e-3432.85Mitochondrial-processing peptidase subunit beta OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-019-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY660159 ID=EY660159; Name=EY660159; organism=Citrus sinensis; type=EST; length=876bp
CCACGCGTCCGGTAAAACCAAGATTTCTACTCTACCAAATGGTGTCAAAA
TTGCCTCGGAAACATCAGTGAGTCCTGTAGCCTCAATATCGTTATATGTT
GGTTGTGGTTCAATTTATGAGTCACCAATCTCATTTGGGACAACACACTT
GCTTGAGCGTATGGCTTTTAGAAGTACAAGAAATAGGAGTCACTTGCGTA
TTGTGCGAGAAGTGGAGGCAATTGGTGGCAATGTCCAAGCCTCAGCTTCT
AGGGAGCAGATGGGTTACTCCTTTGATGCTTTGAAAACTTATGTTCCTGA
AATGGTAGAGCTTCTTATTGACTGTGTGAGAAACCCTGTTTTTCTGGATT
GGGAGGTCAACGAACAGCTCACAAAGGTGAAATCTGAGATTAGTGAGGTT
TCCAACAATCCTCAAAGCTTGCTTTTGGAGGCAATTCACTCAGCTGGTTA
CTCTGGTGCATTGGCTAATCCTCTTCTAGCCCCGGAATCTGCTATAAATA
GATTAAACTCTACACTTCTCGAAGAATTTGTTGCTGAAAATTATACTGGT
CCTCGGATGGTACTTGCTGCTTCTGGTGTTGAACATGACCAGTTGGTGTC
TGTAGCAGAACCACTTTTATCTGACCTACCCAGTATCCATCCTCGCGAAG
AGCCCAAATCTGTGTACACTGGAGGTGATTATCGTTGTCAAGCTGATTCA
GGGGACCAGTTAACCCATTTTGTTCTTGCATTTGAACTTCCTGGTGGTTG
GCATAAGGATAAAGATGCCATGACTTTGACAGTTCTCCAGATGCTTTTGG
GGAGGAGTGGATCATTCTCAGCTGGGGGCCCTGGAAAAGAATGTACTCAN
GGCTGNATCGTCGTGTGTGAATGAGT
back to top