EY659673

Overview
NameEY659673
Unique NameEY659673
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659673_ssr70 microsatellite EY659673_ssr70:70..84. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: PBS1_ARATH (Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.094e-41
Identity = 83/149 (55.70%), Postives = 105/149 (70.47%), Query Frame = 1
Query:  130 EVDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQLHG-PSHGSALTWHMRMKIALDTARGLEYLHEHCNPAVIHRDLKSSNILLDSKFNAKLSDFGLAITDGSQNKNNL--KLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            EV +LS +HHPN+V L+GY A  D R +VYE M   SL+  LH  P    AL W+MRMKIA   A+GLE+LH+  NP VI+RD KSSNILLD  F+ KLSDFGLA    + +K+++  ++ GT GY APEY + G+LT KSDVY+FGVV
Sbjct:  131 EVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEALDWNMRMKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVV 279          

HSP 2 Score: 36.5798 bits (83), Expect = 1.094e-41
Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 3
Query:  624 QSIVTWAMPQLTDXI*LXYIVDPVIKSTMDLKHLYXVAAVAGLCVQPE 767
            Q++V WA P   D      + DP +K     + LY   AVA +C+Q +
Sbjct:  299 QNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQ 346          
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: RLCK7_ARATH (Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.354e-38
Identity = 78/149 (52.35%), Postives = 97/149 (65.10%), Query Frame = 1
Query:  130 EVDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQLHG-PSHGSALTWHMRMKIALDTARGLEYLHEHCNPAVIHRDLKSSNILLDSKFNAKLSDFGLAITDGSQNKNNL--KLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            EV  LS   HPN+V L+G+ A  D R +VYE M   SL+  LH  PS    L W+ RMKIA   ARGLEYLH+   P VI+RDLK SNILL   +  KLSDFGLA    S +K ++  ++ GT GY AP+Y + G+LT KSD+Y+FGVV
Sbjct:  148 EVLTLSLADHPNLVKLIGFCAEGDQRLLVYEYMPQGSLEDHLHVLPSGKKPLDWNTRMKIAAGAARGLEYLHDRMTPPVIYRDLKCSNILLGEDYQPKLSDFGLAKVGPSGDKTHVSTRVMGTYGYCAPDYAMTGQLTFKSDIYSFGVV 296          

HSP 2 Score: 39.2762 bits (90), Expect = 2.354e-38
Identity = 16/51 (31.37%), Postives = 30/51 (58.82%), Query Frame = 3
Query:  624 QSIVTWAMPQLTDXI*LXYIVDPVIKSTMDLKHLYXVAAVAGLCVQPEPSI 776
            Q++V WA P   D      +VDP+++    ++ LY   A++ +CVQ +P++
Sbjct:  316 QNLVGWARPLFKDRRNFPKMVDPLLQGQYPVRGLYQALAISAMCVQEQPTM 366          
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: SRF8_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsis thaliana GN=SRF8 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.971e-38
Identity = 71/147 (48.30%), Postives = 96/147 (65.31%), Query Frame = 1
Query:  133 VDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQLHGPSHGSA-LTWHMRMKIALDTARGLEYLHEHCNPAVIHRDLKSSNILLDSKFNAKLSDFGL-AITDGSQNKNNLKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            V  +S + HPN+V L GY      R +VYE + N +LD  LH     S  LTW+ R+K+AL TA+ LEYLHE C P+++HR+ KS+NILLD + N  LSD GL A+T  ++ + + ++ G+ GY APE+ L G  T KSDVY FGVV
Sbjct:  442 VSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVV 588          

HSP 2 Score: 44.2838 bits (103), Expect = 3.971e-38
Identity = 22/49 (44.90%), Postives = 27/49 (55.10%), Query Frame = 3
Query:  624 QSIVTWAMPQLTDXI*LXYIVDPVIKSTMDLKHLYXVAAVAGLCVQPEP 770
            QS+V WA PQL D   L  +VDP +      K L   A +  LC+QPEP
Sbjct:  608 QSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEP 656          
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: Y1677_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g67720 OS=Arabidopsis thaliana GN=At1g67720 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 6.718e-38
Identity = 80/147 (54.42%), Postives = 98/147 (66.67%), Query Frame = 1
Query:  130 EVDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQLHGPSHGSALTWHMRMKIALDTARGLEYLHEHCNPAVIHRDLKSSNILLDSKFNAKLSDFGLA-ITDGSQNKNNLKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            EV LLS IHH N+V L+GY    D R +VYE M N SL   LHG S    L W  R++IA D A+GLEYLH  CNP++IHRD+KSSNILLD    AK+SDFGL+  T+      +    GT+GY+ PEY    +LT+KSDVY+FGVV
Sbjct:  650 EVALLSRIHHRNLVPLIGYCEEADRRILVYEYMHNGSLGDHLHGSSDYKPLDWLTRLQIAQDAAKGLEYLHTGCNPSIIHRDVKSSNILLDINMRAKVSDFGLSRQTEEDLTHVSSVAKGTVGYLDPEYYASQQLTEKSDVYSFGVV 796          

HSP 2 Score: 26.9498 bits (58), Expect = 6.718e-38
Identity = 11/27 (40.74%), Postives = 18/27 (66.67%), Query Frame = 3
Query:  681 IVDPVIKSTMDLKHLYXVAAVAGLCVQ 761
            I+DP I S + ++ ++ VA VA  CV+
Sbjct:  834 IIDPCIASNVKIESVWRVAEVANQCVE 860          
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: SRF6_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Arabidopsis thaliana GN=SRF6 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.034e-36
Identity = 68/146 (46.58%), Postives = 90/146 (61.64%), Query Frame = 1
Query:  133 VDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQLH-GPSHGSALTWHMRMKIALDTARGLEYLHEHCNPAVIHRDLKSSNILLDSKFNAKLSDFGLAITDGSQNKNNLKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            V  ++N+ HPNV  L+GY A      +VYE  +N SL   LH       AL W+ R+KIAL TAR LEYLHE C+P+++ +++KS+NILLDS+ N  LSD GLA        N L      GY APE  + G+ + KSD+Y+FGVV
Sbjct:  463 VSKIANLDHPNVTKLVGYCAEHGQHLVVYEFHKNGSLHDFLHLSEEESKALVWNSRVKIALGTARALEYLHEVCSPSIVDKNIKSANILLDSELNPHLSDSGLA--SFLPTANELLNQTDEGYSAPEVSMSGQYSLKSDIYSFGVV 606          

HSP 2 Score: 48.521 bits (114), Expect = 6.034e-36
Identity = 25/49 (51.02%), Postives = 29/49 (59.18%), Query Frame = 3
Query:  624 QSIVTWAMPQLTDXI*LXYIVDPVIKSTMDLKHLYXVAAVAGLCVQPEP 770
            QS+V WA PQL D   L  +VDP +K    +K L   A V  LCVQPEP
Sbjct:  626 QSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEP 674          
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 137.887 bits (346), Expect = 2.254e-35
Identity = 73/148 (49.32%), Postives = 95/148 (64.19%), Query Frame = 1
Query:  130 EVDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQLHGPSHGSALT-WHMRMKIALDTARGLEYLHEHCNPAVIHRDLKSSNILLDSKFNAKLSDFGLA-ITDGSQNKNNLKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            EV+ LS   HPN+V L G+  + + R ++Y  MEN SLD  LH  + G AL  W  R++IA   A+GL YLHE C+P ++HRD+KSSNILLD  FN+ L+DFGLA +    +   +  L GTLGY+ PEY      T K DVY+FGVV
Sbjct:  778 EVETLSRAQHPNLVLLRGFCFYKNDRLLIYSYMENGSLDYWLHERNDGPALLKWKTRLRIAQGAAKGLLYLHEGCDPHILHRDIKSSNILLDENFNSHLADFGLARLMSPYETHVSTDLVGTLGYIPPEYGQASVATYKGDVYSFGVV 925          

HSP 2 Score: 32.7278 bits (73), Expect = 2.254e-35
Identity = 15/59 (25.42%), Postives = 31/59 (52.54%), Query Frame = 3
Query:  594 PVEILAPAQCQSIVTWAMPQLTDXI*LXYIVDPVIKSTMDLKHLYXVAAVAGLCVQPEP 770
            PV++  P  C+ +++W + ++        + DP+I S  + K ++ V  +A LC+   P
Sbjct:  935 PVDMCKPKGCRDLISWVV-KMKHESRASEVFDPLIYSKENDKEMFRVLEIACLCLSENP 992          
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: MEE39_ARATH (Probable LRR receptor-like serine/threonine-protein kinase MEE39 OS=Arabidopsis thaliana GN=MEE39 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.615e-35
Identity = 72/149 (48.32%), Postives = 103/149 (69.13%), Query Frame = 1
Query:  130 EVDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQLHGPSHGSALTWHMRMKIALDTARGLEYLHEHCNPAVIHRDLKSSNILLDSKFNAKLSDFGLAIT---DGSQNKNNLKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            EV+LL  +HH N+V L+GY    D   ++YE M N  L   L G   GS L W  R++IA++ A GLEYLH  C PA++HRD+KS+NILLD +F AK++DFGL+ +    G Q++ +  ++GTLGY+ PEY L  +L++KSDVY+FG++
Sbjct:  610 EVELLLRVHHINLVNLVGYCDEQDHFALIYEYMSNGDLHQHLSGKHGGSVLNWGTRLQIAIEAALGLEYLHTGCKPAMVHRDVKSTNILLDEEFKAKIADFGLSRSFQVGGDQSQVSTVVAGTLGYLDPEYYLTSELSEKSDVYSFGIL 758          
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: Y3545_ARATH (Probable receptor-like protein kinase At3g55450 OS=Arabidopsis thaliana GN=At3g55450 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.114e-34
Identity = 75/151 (49.67%), Postives = 101/151 (66.89%), Query Frame = 1
Query:  130 EVDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQL--HGPSHGSALTWHMRMKIALDTARGLEYLHEHCNPA-VIHRDLKSSNILLDSKFNAKLSDFGLAITD--GSQNKNNLKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            E++ L  + HPN+V L+GY   D+ R +VYE M   SL+  L  +G      L+W +R+K+ALD A+GL +LH   +P  VI+RD+K+SNILLDS FNAKLSDFGLA     G Q+  + ++ GT GY APEY+  G L  +SDVY+FGVV
Sbjct:  115 EINYLGQLSHPNLVKLIGYCLEDEQRLLVYEFMHKGSLENHLFANGNKDFKPLSWILRIKVALDAAKGLAFLHS--DPVKVIYRDIKASNILLDSDFNAKLSDFGLARDGPMGEQSYVSTRVMGTFGYAAPEYVSTGHLNARSDVYSFGVV 263          

HSP 2 Score: 31.9574 bits (71), Expect = 1.114e-34
Identity = 18/53 (33.96%), Postives = 28/53 (52.83%), Query Frame = 3
Query:  612 PAQCQSIVTWAMPQLTDXI*LXYIVDPVIKSTMDLKHLYXVAAVAGLCVQPEP 770
            PA+ Q++V WA P LT    +  IVD  + S    +    +A++A  C+  EP
Sbjct:  279 PAKEQNLVDWARPYLTSRRKVLLIVDTRLNSQYKPEGAVRLASIAVQCLSFEP 331          
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: Y2706_ARATH (Probable receptor-like protein kinase At2g47060 OS=Arabidopsis thaliana GN=At2g47060 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.452e-34
Identity = 71/154 (46.10%), Postives = 96/154 (62.34%), Query Frame = 1
Query:  130 EVDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQLHG------PSHGSALTWHMRMKIALDTARGLEYLHEHCNPAVIHRDLKSSNILLDSKFNAKLSDFGLA--ITDGSQNKNNLKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            +V ++S + H N V LLGY    ++R + YE   N SL   LHG         G  L+W+ R+KIA+  ARGLEYLHE  NP +IHRD+KSSN+LL     AK++DF L+    D +   ++ ++ GT GY APEY + G+L  KSDVY+FGVV
Sbjct:  116 QVSMVSRLKHDNFVQLLGYCVDGNSRILSYEFANNGSLHDILHGRKGVKGAQPGPVLSWYQRVKIAVGAARGLEYLHEKANPHIIHRDIKSSNVLLFEDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVV 269          

HSP 2 Score: 36.1946 bits (82), Expect = 1.452e-34
Identity = 28/84 (33.33%), Postives = 40/84 (47.62%), Query Frame = 3
Query:  594 PVEILAPAQCQSIVTWAMPQLTDXI*LXYIVDPVIKSTMDLKHLYXVAAVAGLCVQPE----PSIDTDYXMFALSYSTRPVEPG 833
            PV+   P   QS+VTWA P+L++   +   VD  +      K +  +AAVA LCVQ E    P++           + R V PG
Sbjct:  279 PVDHRLPRGQQSLVTWATPKLSEDK-VKQCVDARLGGDYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNARAVAPG 361          
BLAST of EY659673 vs. ExPASy Swiss-Prot
Match: Y2197_ARATH (Probable protein kinase At2g41970 OS=Arabidopsis thaliana GN=At2g41970 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.891e-34
Identity = 64/155 (41.29%), Postives = 96/155 (61.94%), Query Frame = 1
Query:  127 NEVDLLSNIHHPNVVCLLGYSAHDDTRFIVYELMENRSLDIQLHG------PSHGSALTWHMRMKIALDTARGLEYLHEHCNPAVIHRDLKSSNILLDSKFNAKLSDFGL--AITDGSQNKNNLKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVV 567
            +++ ++S + H + V LLGY    + R ++Y+     SL   LHG         G  L W+ R+KIA   A+GLE+LHE   P ++HRD++SSN+LL   F AK++DF L  A +D +   ++ ++ GT GY APEY + G++T KSDVY+FGVV
Sbjct:  116 SQLSVVSRLKHDHFVELLGYCLEANNRILIYQFATKGSLHDVLHGRKGVQGAEPGPVLNWNQRVKIAYGAAKGLEFLHEKVQPPIVHRDVRSSNVLLFDDFVAKMADFNLTNASSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVV 270          

HSP 2 Score: 42.3578 bits (98), Expect = 1.891e-34
Identity = 29/94 (30.85%), Postives = 48/94 (51.06%), Query Frame = 3
Query:  594 PVEILAPAQCQSIVTWAMPQLTDXI*LXYIVDPVIKSTMDLKHLYXVAAVAGLCVQPEPSIDTDYXMFALSYSTRPVEPGRTLEVAPSGPXANS 875
            PV+   P   QS+VTWA P+L++   +   +DP + +    K +  +AAVA LCVQ E     +     ++   + ++P   L   P+GP + S
Sbjct:  280 PVDHTMPKGQQSLVTWATPRLSEDK-VKQCIDPKLNNDFPPKAVAKLAAVAALCVQYEADFRPN-----MTIVVKALQP--LLNSKPAGPESTS 365          
The following BLAST results are available for this feature:
BLAST of EY659673 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 474
Match NameE-valueIdentityDescription
PBS1_ARATH1.094e-4155.70Serine/threonine-protein kinase PBS1 OS=Arabidopsi... [more]
RLCK7_ARATH2.354e-3852.35Probable serine/threonine-protein kinase RLCKVII O... [more]
SRF8_ARATH3.971e-3848.30Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsi... [more]
Y1677_ARATH6.718e-3854.42Probable LRR receptor-like serine/threonine-protei... [more]
SRF6_ARATH6.034e-3646.58Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Arabidopsi... [more]
PSKR1_ARATH2.254e-3549.32Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]
MEE39_ARATH7.615e-3548.32Probable LRR receptor-like serine/threonine-protei... [more]
Y3545_ARATH1.114e-3449.67Probable receptor-like protein kinase At3g55450 OS... [more]
Y2706_ARATH1.452e-3446.10Probable receptor-like protein kinase At2g47060 OS... [more]
Y2197_ARATH1.891e-3441.29Probable protein kinase At2g41970 OS=Arabidopsis t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659673 ID=EY659673|Name=EY659673|organism=Citrus sinensis|type=EST|length=918bp
CAACACAATATGCCGGCAGAGAATTTGAGGTACTATTTGTTTAAGGGGAT
TTATAAATTTTGAAATCTATGTTGTTGTTGTTGTAGTTGTTGTGCTGTTC
TAATTTTGAGTTGTTTGTGATTGCAGAATGAGGTGGATTTGCTGAGTAAT
ATTCACCACCCAAATGTTGTTTGTCTGTTGGGTTATAGTGCTCATGATGA
CACAAGGTTTATTGTTTATGAATTGATGGAAAATCGGTCCCTTGATATTC
AATTGCATGGTCCTTCTCATGGATCAGCATTGACTTGGCATATGCGAATG
AAAATTGCTCTTGATACCGCTAGAGGATTAGAATATTTACATGAGCACTG
CAACCCTGCAGTCATTCATAGAGATCTGAAATCCTCCAATATACTTCTAG
ATTCCAAGTTTAATGCTAAGCTCTCAGATTTTGGTCTTGCCATAACCGAT
GGATCCCAAAACAAGAACAATCTTAAGCTTTCGGGCACTTTGGGATATGT
GGCTCCCGAGTATCTTTTAGATGGTAAATTGACAGACAAGAGTGATGTCT
ATGCTTTTGGAGTTGTGCTTCTTGAACTTCTCTTATGATGATGCCAGTGG
AGATACTGGCACCAGCTCAGTGCCAATCTATTGTCACATGGGCCATGCCT
CAACTCACTGACAGNATCTAACTCCNATACATTGTGGATCCTGTGATTAA
AAGTACCATGGATTTAAAGCATTTATACCANGTTGCAGCTGTTGCTGGGT
TATGTGTGCAACCGGAGCCAAGTATCGACACTGATTACNGGATGTTTGCA
CTCTCTTATTCCACTCGTCCAGTGGAGCCTGGNAGGACTCTGGAGGTTGC
ACCATCTGGACCTNCTGCAAACTCCACTATACTTCTGGACACTGATTGCT
GACGCATGAACATTTTTT
back to top