EY659665

Overview
NameEY659665
Unique NameEY659665
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length892
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7492 contig Csv1_Contig7492:1..893. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: MAM3_YEAST (Protein MAM3 OS=Saccharomyces cerevisiae GN=MAM3 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.069e-21
Identity = 61/158 (38.61%), Postives = 92/158 (58.23%), Query Frame = 2
Query:    2 PIGKILDAVLGH-HDALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGN-PKNIIGLLLN*VKSLLTVRAETETPVSAVSIRRMPRVPADMPLYDILNEFQKGSSHM 469
            PI  +LD +LG  H  +++++ LK LV++H     +   LT DE TIIS  LDL  K  EE MTPIE+ F++  ++ LD + + KI   G SR+PI+  N P N IG+LL  V+ L++   +   P+S   +  +P    +    +ILN FQ+G +HM
Sbjct:  199 PIATLLDYMLGEDHGTMYKKSGLKTLVTLHRTMGVE--RLTKDEVTIISAVLDLKAKRVEEIMTPIENVFTMSADTILDDKTVEKIFNSGFSRIPIFLPNEPNNFIGMLL--VRVLISYDPDDCLPISHFPLATLPETSPNTSCLNILNYFQEGKAHM 352          
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: YJ23_SCHPO (Uncharacterized protein C4B3.03c OS=Schizosaccharomyces pombe GN=SPCC4B3.03c PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.027e-20
Identity = 61/158 (38.61%), Postives = 96/158 (60.76%), Query Frame = 2
Query:    2 PIGKILDAVLGHHDA-LFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYS-GNPKNIIGLLLN*VKSLLTVRAETETPVSAVSIRRMPRVPADMPLYDILNEFQKGSSHM 469
            P   ILDA LG   + +++++ LK LV++H ++ G   +L  DE TII+  LDL EK AE  MTPIE  F+L ++  LD + IG+I+  G+SR+P++  G P + IG+LL   K+L+    + + PV   ++  +P+   +    D+LN  Q+G SHM
Sbjct:  200 PTALILDACLGESQSTMYKKSGLKTLVTLH-RDLGID-KLNQDEVTIITAVLDLREKHAESIMTPIEDVFTLPMDRILDEDLIGEIICAGYSRIPVHKPGFPHDFIGMLL--TKTLIGYDPDDKWPVGKFALATLPQTWPNTSCLDLLNYCQEGKSHM 353          
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: CNNM4_XENTR (Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.830e-16
Identity = 51/161 (31.68%), Postives = 86/161 (53.42%), Query Frame = 2
Query:    2 PIGKILDAVLGHH-DALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPKNIIGLLLN*VKSLLTVRAETETPVSAVS---IRRMPRVPADMPLYDILNEFQKGSSHMA 472
            P+ ++LD  LG     ++ R +L  ++ +    +G    +  +E  II GAL+L  KT E+ MT +E  F L  ++ LD+  +  I+  G++R+P+Y     NI+ +L   VK L  V  +  TP+S ++      +  V +D  L  +L EF+KG SH+A
Sbjct:  316 PVSRLLDCALGQEIGTVYNREKLLEMLKVTEPYSG----IVREEMNIIQGALELRTKTVEDVMTKVEDCFMLPSDAVLDFNTMSSIMESGYTRIPVYENERSNIVDILY--VKDLAFVDPDDCTPLSTITRFYSHPLHFVFSDTKLDAVLEEFKKGKSHLA 470          
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: CNNM2_RAT (Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.215e-15
Identity = 52/161 (32.30%), Postives = 85/161 (52.80%), Query Frame = 2
Query:    2 PIGKILDAVLGHH-DALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPKNIIGLLLN*VKSLLTVRAETETPVSAVS---IRRMPRVPADMPLYDILNEFQKGSSHMA 472
            P+ K+LD VLG     ++ R +L  ++ +         +L  +E  II GAL+L  KT E+ MTP+   F +   + LD+  + +I+  G++R+P++ G   NI+ LL   VK L  V  +  TP+  ++      +  V  D  L  +L EF+KG SH+A
Sbjct:  392 PVSKLLDCVLGQEIGTVYNREKLLEMLRVTDPY----NDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLF--VKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLA 546          
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: CNNM2_MOUSE (Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 2.215e-15
Identity = 52/161 (32.30%), Postives = 85/161 (52.80%), Query Frame = 2
Query:    2 PIGKILDAVLGHH-DALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPKNIIGLLLN*VKSLLTVRAETETPVSAVS---IRRMPRVPADMPLYDILNEFQKGSSHMA 472
            P+ K+LD VLG     ++ R +L  ++ +         +L  +E  II GAL+L  KT E+ MTP+   F +   + LD+  + +I+  G++R+P++ G   NI+ LL   VK L  V  +  TP+  ++      +  V  D  L  +L EF+KG SH+A
Sbjct:  392 PVSKLLDCVLGQEIGTVYNREKLLEMLRVTDPY----NDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLF--VKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLA 546          
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: CNNM2_HUMAN (Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 2.215e-15
Identity = 52/161 (32.30%), Postives = 85/161 (52.80%), Query Frame = 2
Query:    2 PIGKILDAVLGHH-DALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPKNIIGLLLN*VKSLLTVRAETETPVSAVS---IRRMPRVPADMPLYDILNEFQKGSSHMA 472
            P+ K+LD VLG     ++ R +L  ++ +         +L  +E  II GAL+L  KT E+ MTP+   F +   + LD+  + +I+  G++R+P++ G   NI+ LL   VK L  V  +  TP+  ++      +  V  D  L  +L EF+KG SH+A
Sbjct:  392 PVSKLLDCVLGQEIGTVYNREKLLEMLRVTDPY----NDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLF--VKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLA 546          
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: CNNM1_MOUSE (Metal transporter CNNM1 OS=Mus musculus GN=Cnnm1 PE=1 SV=4)

HSP 1 Score: 79.337 bits (194), Expect = 3.199e-14
Identity = 55/161 (34.16%), Postives = 88/161 (54.66%), Query Frame = 2
Query:    2 PIGKILDAVLGHHDALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPK-NIIGLLLN*VKSLLTVRAETETPVSAVS---IRRMPRVPADMPLYDILNEFQKGSSHMA 472
            P+G++LD  L    + F   + K L ++ +  A    +L  +E  II GAL+L  K  EE +TP+   F L  ++ LD+  + +IL  G++R+P+Y G+ + NI+ +L   VK L  V  +  TP+  V+    R +  V  D  L  +L EF+KG SH+A
Sbjct:  304 PLGRLLDWALPQEISTFYTRE-KLLETLRA--ADPYSDLVKEELNIIQGALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILF--VKDLAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLA 459          
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: CNNM1_HUMAN (Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 PE=2 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 3.199e-14
Identity = 55/161 (34.16%), Postives = 88/161 (54.66%), Query Frame = 2
Query:    2 PIGKILDAVLGHHDALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPK-NIIGLLLN*VKSLLTVRAETETPVSAVS---IRRMPRVPADMPLYDILNEFQKGSSHMA 472
            P+G++LD  L    + F   + K L ++ +  A    +L  +E  II GAL+L  K  EE +TP+   F L  ++ LD+  + +IL  G++R+P+Y G+ + NI+ +L   VK L  V  +  TP+  V+    R +  V  D  L  +L EF+KG SH+A
Sbjct:  304 PLGRLLDWALRQEISTFYTRE-KLLETLRA--ADPYSDLVKEELNIIQGALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILF--VKDLAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLA 459          
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: CNNM4_RAT (Metal transporter CNNM4 OS=Rattus norvegicus GN=Cnnm4 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.074e-13
Identity = 50/163 (30.67%), Postives = 84/163 (51.53%), Query Frame = 2
Query:    2 PIGKILDAVLGHH-DALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPKNIIGLLLN*VKSLLTVRAETETPVSAVSIRRMPRVPADMPLYD-----ILNEFQKGSSHMA 472
            PI K+LD VLG     ++ R +L  ++ +         +L  +E  +I GAL+L  KT E+ MT +   F +  ++ LD+  + +I+  G++R+P++     NI+ +L   VK L  V  +  TP+   +I R    P     +D     +L EF+KG SH+A
Sbjct:  317 PISKLLDFVLGQEIRTVYNREKLMEMLKVTEPY----NDLVKEELNMIQGALELRTKTVEDIMTQLHDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVDILY--VKDLAFVDPDDCTPLK--TITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLA 471          
BLAST of EY659665 vs. ExPASy Swiss-Prot
Match: CNNM4_MOUSE (Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 2.074e-13
Identity = 50/163 (30.67%), Postives = 84/163 (51.53%), Query Frame = 2
Query:    2 PIGKILDAVLGHH-DALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAIGKILARGHSRVPIYSGNPKNIIGLLLN*VKSLLTVRAETETPVSAVSIRRMPRVPADMPLYD-----ILNEFQKGSSHMA 472
            PI K+LD VLG     ++ R +L  ++ +         +L  +E  +I GAL+L  KT E+ MT +   F +  ++ LD+  + +I+  G++R+P++     NI+ +L   VK L  V  +  TP+   +I R    P     +D     +L EF+KG SH+A
Sbjct:  316 PISKLLDFVLGQEIRTVYNREKLMEMLKVTEPY----NDLVKEELNMIQGALELRTKTVEDIMTQLHDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVDILY--VKDLAFVDPDDCTPLK--TITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLA 470          
The following BLAST results are available for this feature:
BLAST of EY659665 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
MAM3_YEAST2.069e-2138.61Protein MAM3 OS=Saccharomyces cerevisiae GN=MAM3 P... [more]
YJ23_SCHPO1.027e-2038.61Uncharacterized protein C4B3.03c OS=Schizosaccharo... [more]
CNNM4_XENTR5.830e-1631.68Metal transporter CNNM4 OS=Xenopus tropicalis GN=c... [more]
CNNM2_RAT2.215e-1532.30Metal transporter CNNM2 OS=Rattus norvegicus GN=Cn... [more]
CNNM2_MOUSE2.215e-1532.30Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 P... [more]
CNNM2_HUMAN2.215e-1532.30Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 P... [more]
CNNM1_MOUSE3.199e-1434.16Metal transporter CNNM1 OS=Mus musculus GN=Cnnm1 P... [more]
CNNM1_HUMAN3.199e-1434.16Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 P... [more]
CNNM4_RAT2.074e-1330.67Metal transporter CNNM4 OS=Rattus norvegicus GN=Cn... [more]
CNNM4_MOUSE2.074e-1330.67Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-G05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659665 ID=EY659665|Name=EY659665|organism=Citrus sinensis|type=EST|length=892bp
TCCTATTGGAAAGATTCTTGATGCTGTTCTTGGACACCATGATGCTTTGT
TCAGGCGGGCCCAGTTGAAAGCCCTTGTTTCTATCCACAGCCAAGAGGCT
GGCAAGGGAGGTGAACTTACTCATGATGAGACGACTATTATCAGTGGAGC
ACTAGACTTAACTGAAAAGACTGCGGAGGAGGCTATGACGCCCATTGAGT
CAACATTTTCCTTAGATGTCAATTCGAAATTAGACTGGGAAGCAATTGGA
AAAATTCTCGCTCGAGGTCATAGTCGTGTACCTATTTATTCTGGAAATCC
TAAAAACATTATTGGTCTCTTACTGAATTAGGTGAAAAGCCTTCTTACAG
TACGGGCAGAGACAGAAACTCCAGTGAGTGCTGTTTCTATACGGAGAATG
CCAAGGGTTCCAGCAGATATGCCTTTATATGATATCCTCAACGAGTTTCA
AAAGGGTAGCAGTCATATGGCTGCTGTAGTGAAGGTTAAAGGAAAGAGCA
AAAAATCCCAGTCTATCAGCCTGGGAGAGAAATTTGGGGGAAACGGTGTT
TTCTCTGGGAATTCTCAATTAACTACTCCCTTGCTAACCAACGATGTTAC
ATCAGAAACTACTCCCTTGCTAACCAACGATGTTACATCAGAAAGTGTTG
TTGTTGGCATTGACAGAACATCAAGGCCCAACACAAATAACCAATCTCTG
CCACACAGCTTGGTGCTGCTGCAGAAAACTTGCCTTACTCATTANAGGAT
AATTGAGAAGGAGTAGTCATGGNCATCATCACCCTTGAAGATGTTTTTGA
AAGACCTCCTGCAGAGGAAATAGTGNATGAAACTGATGTTTATGTTCGAT
GTCACTAAAAGGAACAAATGGGCTGCTGCGCTGCANCTGCTT
back to top