EY659659

Overview
NameEY659659
Unique NameEY659659
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659659 vs. ExPASy Swiss-Prot
Match: PP395_ARATH (Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.643e-32
Identity = 64/133 (48.12%), Postives = 95/133 (71.43%), Query Frame = 1
Query:   22 QPQNADSILTSMLKYGVHPNVVMSTTVISGWCNAAKMQRAMTIYEKMCEIC-INPNLKTYETLLWGYGEAKQPWRAKKLLQVMENKGVRPNNSTIQLVPDSWRAIGLAREANRVLISA*KHTLSMPNKNDDIA 417
            +P+ A+ IL  M K+GV PNVV+ T +ISGWC+A +M++AM +Y+KMC I  ++PNL TYETL+WG+GEAKQPW+A++LL+ ME K V P   T+QL+ D W++IG++   +   + +   T S  N  ++IA
Sbjct:  651 EPEKAEQILNQMRKFGVRPNVVIYTQIISGWCSAGEMKKAMQVYKKMCGIVGLSPNLTTYETLIWGFGEAKQPWKAEELLKDMEGKNVVPTRKTMQLIADGWKSIGVSNSNDANTLGSSFSTSSKLNIPNNIA 783          
BLAST of EY659659 vs. ExPASy Swiss-Prot
Match: PP397_ARATH (Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 6.898e-30
Identity = 74/218 (33.94%), Postives = 122/218 (55.96%), Query Frame = 1
Query:   25 PQNADSILTSMLKYGVHPNVVMSTTVISGWCNAAKMQRAMTIYEKMCEICINPNLKTYETLLWGYGEAKQPWRAKKLLQVMENKGVRPNNSTIQLVPDSWRAIGLAREANRVLISA*KHTLSMPNKNDDIA-VDSIHMKQNLKASNSTFLQIPVVLSSDHNGS*PAKITIQIVLTSDTEWTATKSLFINTYGYRVQPMVVCKKQCNL-VGTCGQYVHA 672
            P+ A+ +L +++     PNVV+ TTVISGWC+   M  AM ++ KMC+  ++PN+KT+ETL+WGY E KQPW+A+++LQ+M   GV+P NST  L+ ++WR  GL  E+N+ +        ++  K+ +IA ++ ++ KQ+   S+   LQIPV                        E    K++ ++      +  ++C+KQ     G  GQ+VH+
Sbjct:  381 PKKAEELLETLIVES-RPNVVIFTTVISGWCSNGSMDDAMRVFNKMCKFGVSPNIKTFETLMWGYLEVKQPWKAEEVLQMMRGCGVKPENSTFLLLAEAWRVAGLTDESNKAI-------NALKCKDIEIAKLEKLYQKQS-SGSSFNLLQIPV---------------------GKRELPTAKAMNLSACKLGARVPIICQKQSQAQFGISGQFVHS 568          
The following BLAST results are available for this feature:
BLAST of EY659659 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PP395_ARATH5.643e-3248.12Pentatricopeptide repeat-containing protein At5g21... [more]
PP397_ARATH6.898e-3033.94Pentatricopeptide repeat-containing protein At5g25... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-F09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659659 ID=EY659659|Name=EY659659|organism=Citrus sinensis|type=EST|length=878bp
AAAGCTATGTGCGTGCTGGTACAGCCTCAGAACGCTGATTCAATTCTGAC
TTCCATGCTCAAATATGGCGTGCATCCAAATGTTGTAATGTCCACTACTG
TCATCAGTGGGTGGTGCAATGCTGCAAAGATGCAACGTGCAATGACTATT
TATGAGAAAATGTGTGAAATATGCATTAATCCCAATTTGAAAACATATGA
AACTCTATTGTGGGGATATGGAGAAGCAAAACAGCCCTGGAGAGCAAAAA
AATTGCTGCAGGTGATGGAAAATAAAGGTGTCCGTCCTAATAACAGCACC
ATCCAACTTGTACCTGATTCATGGCGTGCTATTGGTTTGGCAAGGGAGGC
CAATAGAGTTCTCATAAGTGCATAAAAACATACGCTATCCATGCCAAATA
AAAACGATGATATAGCAGTCGATAGCATTCACATGAAGCAAAATCTTAAA
GCTTCAAATTCTACTTTTTTGCAGATACCTGTGGTACTGTCGAGTGACCA
CAATGGGTCTTGACCTGCTAAAATTACAATCCAAATAGTTCTGACATCTG
ACACTGAGTGGACTGCAACTAAATCCTTATTCATCAATACATATGGTTAC
AGAGTGCAACCAATGGTTGTATGCAAGAAACAATGTAATCTGGTTGGTAC
ATGTGGGCAGTATGTACATGCATACAGATTGGAGTTCATAAATAGATGGG
TGCCGGGATCATACTTTTTACCAACGTATGGTGACACACCGGTGGAGGGA
AGATGCTATATCAACTGCTTCGAGTCATGATGCTGACTATCACTTGCTTT
CCAAATCGTTAAACTAGACATGCTGAAAATGTGACAAGACTCTACATGCC
TTGCTTTTGGGGCTGGTCCCATTGGTTT
back to top