EY659642

Overview
NameEY659642
Unique NameEY659642
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length955
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659642 vs. ExPASy Swiss-Prot
Match: FHIT_DICDI (Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium discoideum GN=fhit PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 4.631e-32
Identity = 60/104 (57.69%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  166 FGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFE 477
            FGP+ I   E+F++T LS+A+VNL+P+LPGHVLVC +R   R  DLT +E TDLWL+AQ++   +E +  G   TFAIQDG  AGQTV HVHIH++PRK  DFE
Sbjct:    6 FGPWLIRQSEIFFTTELSFALVNLKPVLPGHVLVCPKRIVPRVKDLTKEEFTDLWLSAQRISSVVEEHFNGDGITFAIQDGKNAGQTVEHVHIHIIPRKKFDFE 109          

HSP 2 Score: 26.9498 bits (58), Expect = 4.631e-32
Identity = 15/51 (29.41%), Postives = 25/51 (49.02%), Query Frame = 2
Query:  461 KLVTLKKNDEIYDAIEVKEKELQQKLDLDKERKDRCLQEMNQDADQYRSVF 613
            K    + ND+IY+ IE             KER+ R  +EM +++ + R +F
Sbjct:  104 KKFDFENNDQIYNEIE-------------KEREPRSYEEMEKESSELRPLF 141          
BLAST of EY659642 vs. ExPASy Swiss-Prot
Match: FHIT_BOVIN (Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=FHIT PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.869e-30
Identity = 58/107 (54.21%), Postives = 79/107 (73.83%), Query Frame = 1
Query:  160 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEK 480
            F FG + I    VF  T LS+A+VN +P++PGHVLVC  R  +RF D++ +E  DL+  AQ+VG  +E + +G+S TF++QDGPEAGQTV HVH+H+LPRKAGDF +
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQAAQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHVHILPRKAGDFHR 109          

HSP 2 Score: 25.409 bits (54), Expect = 1.869e-30
Identity = 16/45 (35.56%), Postives = 22/45 (48.89%), Query Frame = 2
Query:  479 KNDEIYDAIEVKEKELQQKLDLDKERKDRCLQEMNQDADQYRSVF 613
            +ND IYDA+E  ++E     D D     R  +EM  +A   R  F
Sbjct:  109 RNDSIYDALEKHDRE-----DKDSPALWRSEEEMAAEAAALRVYF 148          
BLAST of EY659642 vs. ExPASy Swiss-Prot
Match: FHIT_HUMAN (Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN=FHIT PE=1 SV=3)

HSP 1 Score: 130.183 bits (326), Expect = 1.748e-29
Identity = 61/107 (57.01%), Postives = 77/107 (71.96%), Query Frame = 1
Query:  160 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEK 480
            F FG + I    VF  T LS+A+VN +P++PGHVLVC  R  +RF DL  DE  DL+ T Q+VG  +E +  G+S TF++QDGPEAGQTV HVH+HVLPRKAGDF +
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHR 109          
BLAST of EY659642 vs. ExPASy Swiss-Prot
Match: FHIT_RAT (Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegicus GN=Fhit PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 4.436e-29
Identity = 57/107 (53.27%), Postives = 77/107 (71.96%), Query Frame = 1
Query:  160 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEK 480
            F FG + I    VF  T LS+A+VN +P++PGHVL+C  R  +RF DL  DE  DL+   Q+VG  +E + +G+S TF++QDGPEAGQTV HVH+H+LPRK+GDF +
Sbjct:    3 FKFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLMCPLRPVERFRDLRPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHILPRKSGDFRR 109          

HSP 2 Score: 23.0978 bits (48), Expect = 4.436e-29
Identity = 13/46 (28.26%), Postives = 24/46 (52.17%), Query Frame = 2
Query:  476 KKNDEIYDAIEVKEKELQQKLDLDKERKDRCLQEMNQDADQYRSVF 613
            ++ND IYD ++  ++E     + D     R  +EM  +A+  R+ F
Sbjct:  108 RRNDNIYDELQKHDRE-----EEDSPAFWRSEEEMAAEAEVLRAYF 148          
BLAST of EY659642 vs. ExPASy Swiss-Prot
Match: FHIT_MOUSE (Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN=Fhit PE=2 SV=3)

HSP 1 Score: 128.642 bits (322), Expect = 5.085e-29
Identity = 60/107 (56.07%), Postives = 77/107 (71.96%), Query Frame = 1
Query:  160 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEK 480
            F FG + I    VF  T LS+A+VN +P++PGHVLVC  R  +RF DL  DE  DL+   Q+VG  +E + +G+S TF++QDGPEAGQTV HVH+HVLPRKAGDF +
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPR 109          
BLAST of EY659642 vs. ExPASy Swiss-Prot
Match: NFT1_CAEEL (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 7.325e-29
Identity = 59/110 (53.64%), Postives = 74/110 (67.27%), Query Frame = 1
Query:  145 SSTTHFTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDF 474
            S T    F  + I A  +FYSTP S+  VNL+P+  GHVLV  +R   R  DLT  ET DL++ A+KV   LE +H  +STT  +QDG +AGQTVPHVHIH+LPR+AGDF
Sbjct:  294 SETGGLKFARFNIPADHIFYSTPHSFVFVNLKPVTDGHVLVSPKRVVPRLTDLTDAETADLFIVAKKVQAMLEKHHNVTSTTICVQDGKDAGQTVPHVHIHILPRRAGDF 403          

HSP 2 Score: 24.6386 bits (52), Expect = 7.325e-29
Identity = 13/35 (37.14%), Postives = 22/35 (62.86%), Query Frame = 2
Query:  515 EKELQQKL---DLDKERKDRCLQEMNQDADQYRSV 610
            + E+ QKL   D + ERK R  ++M ++A  YR++
Sbjct:  405 DNEIYQKLASHDKEPERKPRSNEQMAEEAVVYRNL 439          
BLAST of EY659642 vs. ExPASy Swiss-Prot
Match: APH1_SCHPO (Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe GN=aph1 PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 7.619e-25
Identity = 50/96 (52.08%), Postives = 66/96 (68.75%), Query Frame = 1
Query:  193 EVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEK 480
            +VFY T LS A VNL+P+LPGHVLV  +R   R  DLT  E TDL+ + +KV + +E     S++   IQDG +AGQTVPHVH+H++PRK  DF +
Sbjct:   15 QVFYRTKLSAAFVNLKPILPGHVLVIPQRAVPRLKDLTPSELTDLFTSVRKVQQVIEKVFSASASNIGIQDGVDAGQTVPHVHVHIIPRKKADFSE 110          

HSP 2 Score: 27.335 bits (59), Expect = 7.619e-25
Identity = 13/43 (30.23%), Postives = 23/43 (53.49%), Query Frame = 2
Query:  485 DEIYDAIEVKEKELQQKLDLDKERKDRCLQEMNQDADQYRSVF 613
            +E Y   E     ++Q +  D++RK R L+EM ++A   +  F
Sbjct:  133 NERYAGDERPPTSMRQAIPKDEDRKPRTLEEMEKEAQWLKGYF 175          
BLAST of EY659642 vs. ExPASy Swiss-Prot
Match: NFT1_DROME (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster GN=NitFhit PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.175e-17
Identity = 41/98 (41.84%), Postives = 61/98 (62.24%), Query Frame = 1
Query:  181 IDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDF 474
            +D + +FY +   +A  NLR ++ GHVLV ++R   R   L   E  D++ T   V + LE  ++ +S T  +QDG +AGQTVPHVH H++PR+ GDF
Sbjct:  323 VDKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTSATVTVQDGAQAGQTVPHVHFHIMPRRLGDF 420          
BLAST of EY659642 vs. ExPASy Swiss-Prot
Match: HNT2_YEAST (Hit family protein 2 OS=Saccharomyces cerevisiae GN=HNT2 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 2.617e-17
Identity = 41/91 (45.05%), Postives = 62/91 (68.13%), Query Frame = 1
Query:  190 KEVFYSTPLSYAMVNLRPLLPGHVLVCS-RREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPR 459
            ++VFY +  +YA+VNL+P++PGHVL+   R      +DLT  E+ D + T Q + + ++  +K  S   AIQDGPEAGQ+VPH+H H++PR
Sbjct:   14 EQVFYKSKYTYALVNLKPIVPGHVLIVPLRTTVLNLSDLTMPESQDYFKTLQLIHRFIKWQYKADSINVAIQDGPEAGQSVPHLHTHIIPR 104          
The following BLAST results are available for this feature:
BLAST of EY659642 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
FHIT_DICDI4.631e-3257.69Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium d... [more]
FHIT_BOVIN1.869e-3054.21Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=F... [more]
FHIT_HUMAN1.748e-2957.01Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN... [more]
FHIT_RAT4.436e-2953.27Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegic... [more]
FHIT_MOUSE5.085e-2956.07Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN... [more]
NFT1_CAEEL7.325e-2953.64Nitrilase and fragile histidine triad fusion prote... [more]
APH1_SCHPO7.619e-2552.08Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] ... [more]
NFT1_DROME1.175e-1741.84Nitrilase and fragile histidine triad fusion prote... [more]
HNT2_YEAST2.617e-1745.05Hit family protein 2 OS=Saccharomyces cerevisiae G... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-E03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659642 ID=EY659642|Name=EY659642|organism=Citrus sinensis|type=EST|length=955bp
GGCCGACCCACGCGTCCGACAACTACTGCTAGCAGGTGTTCTTCTTGGTA
CCTCTCGCATTCATTAAAACGGTGCCGCTCAATCTCCAGCACCACCATCA
CTCTCCCCAAGGCAAGTAAAATCAAATCGGCCTCAGCTCAGATGTCGTCG
ACGACTCATTTTACGTTCGGGCCTTACAAAATTGATGCGAAGGAAGTGTT
CTATAGCACTCCTCTCTCCTACGCCATGGTCAACCTGCGCCCGTTGCTTC
CTGGTCATGTACTTGTCTGCTCGAGGCGTGAAGCAAAGCGCTTTGCTGAT
CTTACAGCTGATGAGACTACTGATTTATGGCTCACAGCCCAAAAGGTTGG
CAAACAGCTCGAAAGCTACCACAAGGGTTCATCAACAACATTTGCCATCC
AAGATGGGCCTGAAGCTGGACAGACAGTACCCCATGTTCACATCCATGTT
CTCCCGCGCAAAGCTGGTGACTTTGAAAAAAAATGATGAGATTTATGATG
CAATAGAGGTGAAGGAGAAGGAATTACAGCAGAAGCTTGATTTGGATAAG
GAAAGGAAAGACAGATGCCTCCAGGAGATGAATCAAGATGCTGATCAATA
CAGGTCGGTTTTCCTGTGAAAATTTAACAGTGGCCTTCATTATGCTTCTC
TTGAACCGTCGCCAAGGCTGCAGAAACTTAGGGCCTCTAAATAAAAACTT
ATGGAATTTTATTGTGGGTTCTAAAACATTGGGCCTGTCTACATTTTTTT
ACATCATATCTCAGATACAGATAATCCTTGCGCCACTCCTCTCACTTGGT
GGATTTTGGAATTCTACATTNTTAGTTGGTATTTTACGTTGGGACCTGGG
TATTCCTATTCCTTATATTGGGTTAAAAGTCGGGGGTGGAAAAAGAATAA
AAAAGAAAAAGGGGGGCGCCTGAGGGTCCAGTTTGTCCCGCGGTGGGAAT
TTTTT
back to top