EY659617

Overview
NameEY659617
Unique NameEY659617
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length908
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659617 vs. ExPASy Swiss-Prot
Match: DCOR_SCHPO (Ornithine decarboxylase OS=Schizosaccharomyces pombe GN=spe1 PE=2 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 7.801e-11
Identity = 22/58 (37.93%), Postives = 36/58 (62.07%), Query Frame = 1
Query:  280 EPDLLEALATMGSNFN*GSRSEIESVWILNVLPDRMIYANRCKPVSHI*NAESVGVQL 453
            +P +L  L   G+ F+  S+ E+E +  L V PDR++YAN CK ++++  A S G+ L
Sbjct:  102 DPKVLALLNKFGTGFDCASKGELEQILGLGVSPDRIVYANPCKAITYVRYAASKGINL 159          

HSP 2 Score: 39.6614 bits (91), Expect = 7.801e-11
Identity = 29/73 (39.73%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  459 TFDLVKELDKILNWAATSDLLIRIKSADDSRTNYTVDTKYGAD-HDTQEIMPVLKAAVS*RLFVVGVLLHLGS 674
            TFD   EL K+      S LL+RI S DDS +   +  K+GA   DT +++ + K+     L VVGV  H+GS
Sbjct:  161 TFDNADELYKVKQHHPNSRLLLRI-STDDSNSLCRLSLKFGASLDDTGKLLDIAKSL---ELNVVGVSFHVGS 229          
The following BLAST results are available for this feature:
BLAST of EY659617 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
DCOR_SCHPO7.801e-1137.93Ornithine decarboxylase OS=Schizosaccharomyces pom... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659617 ID=EY659617|Name=EY659617|organism=Citrus sinensis|type=EST|length=908bp
CCAATCTTTTCTTTATCTATTTGCCATGGGCTCCTGCCCTAAGGGAACTT
CATGCACATTATTGCATATGGATGCACATGTAATGGGAGGCCAGAGAGTC
ACGATGGCGGTCTCAAAAGATGAACTCACTGAATTATGCAGTGAACAATA
TTGAAGAGAAAGAGCTCGAGGAACCACCCTTTTACGTAATGGATTTAAGC
GTTGTGGCTTGTGTCTACAATCATATGATCTCAAACCTTACGATGATTCA
TTCTCACTATGCACGGAAGTGCAATCTCCGAGCCAGACCTTTTGGAAGCA
CTTGCGACTATGGGCTCAAACTTTAACTGAGGAAGCCGATCCGAGATTGA
ATCTGTATGGATACTGAATGTTTTACCGGATCGTATGATTTACGCAAACC
GGTGTAAGCCTGTATCTCACATATAGAATGCTGAGAGTGTTGGCGTACAA
CTTGAGCAACCTTTGATCTAGTAAAGGAGCTCGACAAGATACTGAACTGG
GCTGCGACATCTGATTTATTGATCAGGATCAAATCCGCGGATGATAGCAG
AACGAATTATACGGTGGATACCAAATATGGCGCTGATCATGATACTCAAG
AAATTATGCCTGTTCTCAAAGCCGCTGTATCTTAAAGGCTCTTTGTAGTT
GGGGTATTATTACACCTTGGTAGCGAAGCTACATACTTTGCTGTATTTCA
CGGATCATAGAAACGGCTAAAGCGTAGTTTGAACAGCCGTTCACACGATA
AAAACAAAATGCGTGTGCTATATACAGGGTGAAGGTTCAGGTTCATTAAT
TCTAACCAAAATGTTCTCACATGCGCTTTATCATAAAAGATCTTTTCAGG
CTAGTTTCCAATAATTTTACCATGATCGAGTCTGAAATGATTTCCAGACT
GGCAGGTT
back to top