EY659559

Overview
NameEY659559
Unique NameEY659559
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUC1_ARATH (Sucrose transport protein SUC1 OS=Arabidopsis thaliana GN=SUC1 PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 1.331e-79
Identity = 148/227 (65.20%), Postives = 169/227 (74.45%), Query Frame = 3
Query:   60 PTKNQSSIELRQXXXXXXXX-MWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALLI 737
            PTK+ +++E +          + KI+ VASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGP+SGMIVQPIVGFHSD C+S+FGRRRP                 YAAD  +  GD + + VK RAI IF +GFWILDVANNTLQGPCRA LADL+    K TR AN+ FSFFMAVGNVLGYA GSYT+L+ M PFT +KACD+YCA LKT  FLSI LL+
Sbjct:    9 PTKDAAALETQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRCRSKFGRRRPFIATGAALVAVAVFLIGYAADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLL 235          
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUC5_ARATH (Sucrose transport protein SUC5 OS=Arabidopsis thaliana GN=SUC5 PE=1 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.271e-79
Identity = 144/210 (68.57%), Postives = 164/210 (78.10%), Query Frame = 3
Query:  126 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALLITLRHST 755
            KI+ VASIAAGVQFGWALQLSLLTPY+QLLGIPHKWSS +WLCGPISGMIVQPIVG+HSD C+SRFGRRRP                 +AAD+ HS GD + + V+TRAIIIF+ GFW LDVANNTLQGPCRA LADL+    K TR AN+ FSFFMAVGNVLGYA GSYT+L+ M PFT +KACD+YCA LKT  FLSI LL+ +  S+
Sbjct:   33 KIISVASIAAGVQFGWALQLSLLTPYIQLLGIPHKWSSYMWLCGPISGMIVQPIVGYHSDRCESRFGRRRPFIAAGVALVAVSVFLIGFAADMGHSFGDKLENKVRTRAIIIFLTGFWFLDVANNTLQGPCRAFLADLAAGDAKKTRVANACFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTFSS 242          
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUC2_ARATH (Sucrose transport protein SUC2 OS=Arabidopsis thaliana GN=SUC2 PE=1 SV=2)

HSP 1 Score: 295.049 bits (754), Expect = 3.873e-79
Identity = 158/278 (56.83%), Postives = 187/278 (67.27%), Query Frame = 3
Query:   75 SSIELRQXXXXXXXXMWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALLITLRHSTGLRD*AKIKRD**LRNAAVHNDPFFSEIL-LH*KVAKAMWSYCGDT-VNWM 902
            S++E +         + KI+ V+SIAAGVQFGWALQLSLLTPYVQLLGIPHKW+SLIWLCGPISGM+VQPIVG+HSD C SRFGRRRP                 YAADI HS GD +    KTRAI IF +GFWILDVANNTLQGPCRA LADLS  + K TRTAN+ FSFFMAVGNVLGYA GSY +LY ++PFT +++CD+YCA LKT  FLSI LL+ +   +      K        +    N PFF EI     ++ + MW     T +NW+
Sbjct:   14 SALETQTGELDQPERLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHSMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVSLCYVKEKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWI 291          
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUC6_ARATH (Putative sucrose transport protein SUC6 OS=Arabidopsis thaliana GN=SUC6 PE=5 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 4.283e-78
Identity = 139/208 (66.83%), Postives = 160/208 (76.92%), Query Frame = 3
Query:  120 MWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALLITL 743
            M K++ VASIAAG+QFGWALQLSLLTPYVQLLG+PHKWSS IWLCGP+SG++VQP VG+ SD CKSRFGRRRP                 YAAD  HS GD V + VK RA++IF +GFWILDVANNTLQGPCRA L DL+    K TRTAN+ FSFFMAVGNVLGYA GSYT+LY + PFT +KACD+YCA LK+  FLSI LL+ +
Sbjct:   30 MRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVGYFSDRCKSRFGRRRPFIAMGALLVAVAVVLIGYAADFGHSMGDKVDEPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVV 237          
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUC8_ARATH (Sucrose transport protein SUC8 OS=Arabidopsis thaliana GN=SUC8 PE=1 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 1.055e-76
Identity = 136/206 (66.02%), Postives = 157/206 (76.21%), Query Frame = 3
Query:  126 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALLITL 743
            K++ VASIAAG+QFGWALQLSLLTPYVQLLG+PHKWSS IWLCGP+SG++VQP VG+ SD C SRFGRRRP                 YAAD  HS GD +   VK RA++IF +GFWILDVANNTLQGPCRA L DL+    K TRTAN+ FSFFMAVGNVLGYA GSYT+LY + PFT +KACD+YCA LK+  FLSI LL+ +
Sbjct:   32 KMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVAVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVV 237          
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUC7_ARATH (Putative sucrose transport protein SUC7 OS=Arabidopsis thaliana GN=SUC7 PE=5 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 1.166e-75
Identity = 134/206 (65.05%), Postives = 156/206 (75.73%), Query Frame = 3
Query:  126 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALLITL 743
            K++ VASIAAG+QFGWALQLSLLTPYVQLLG+PHKW S IWLCGP+SG++VQP VG+ SD C SRFGRRRP                 YAAD  HS GD +   VK RA++IF +GFWILDVANNTLQGPCRA L DL+    + TRTAN+ FSFFMAVGNVLGYA GSYT+LY + PFT +KACD+YCA LK+  FLSI LL+ +
Sbjct:   31 KMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWPSFIWLCGPVSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVSVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAQKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVV 236          
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUC9_ARATH (Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.523e-75
Identity = 151/263 (57.41%), Postives = 180/263 (68.44%), Query Frame = 3
Query:  126 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALLITLRHSTGLRD*AKIKRD**LRNAAVHND--PFFSEILLH*KVAK-AMWSYCGDT-VNWM 902
            K++ VASIAAG+QFGWALQLSLLTPYVQLLG+PHKWSS IWLCGPISG++VQP VG+ SD CKSRFGRRRP                 +AAD  H+ GD + ++VK RA+  FV+GFWILDVANNTLQGPCRA L DL+    K TRTAN+ FSFFMAVGNVLGYA GSYT+L+ + PFT +KACD+YCA LK+   +SI LLI L     +     ++      NA   N+  PFF EI    KV K  MW     T +NW+
Sbjct:   32 KMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPISGLLVQPTVGYFSDRCKSRFGRRRPFIATGALLVALAVILIGFAADFGHTMGDKLDEAVKIRAVGFFVVGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAIFSFFMAVGNVLGYAAGSYTNLHKIFPFTVTKACDIYCANLKSCFIISITLLIVLT----IIALWYVEDKQWSPNADSDNEKTPFFGEIFGAFKVMKRPMWMLLAVTALNWI 290          
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUT_SPIOL (Sucrose transport protein OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 9.241e-73
Identity = 133/206 (64.56%), Postives = 157/206 (76.21%), Query Frame = 3
Query:  126 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALLITL 743
            K+ +VAS+AAGVQFGWALQLSLLTPYVQLLGIPH W++ IWLCGPISGMIVQP+VG++SD C SRFGRRRP                 +AADI  ++GD   +  K RAI +FV+GFWILDVANNTLQGPCRALLAD++  S   TR AN+ FSFFMA+GN+ GYA GSY+ LY + PFTK+ ACDVYCA LK+  F+SI LLI L
Sbjct:   37 KLGLVASVAAGVQFGWALQLSLLTPYVQLLGIPHTWAAYIWLCGPISGMIVQPLVGYYSDRCTSRFGRRRPFIAAGAALVAVAVGLIGFAADIGAASGDPTGNVAKPRAIAVFVVGFWILDVANNTLQGPCRALLADMAAGSQTKTRYANAFFSFFMALGNIGGYAAGSYSRLYTVFPFTKTAACDVYCANLKSCFFISITLLIVL 242          
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUC4_ARATH (Sucrose transport protein SUC4 OS=Arabidopsis thaliana GN=SUC4 PE=1 SV=2)

HSP 1 Score: 237.269 bits (604), Expect = 9.585e-62
Identity = 115/202 (56.93%), Postives = 142/202 (70.30%), Query Frame = 3
Query:  129 IVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALL 734
            ++ VAS+A G+QFGWALQLSLLTPYVQ LGIPH W+S+IWLCGP+SG+ VQP+VG  SD C S++GRRRP                 +AADI  + GD     +K RAI+ FV+GFWILDVANN  QGPCRALLADL+ + N+ TR AN  FS FMAVGNVLGYA GSY   Y +  FTK+ AC+V CA LK+  ++ +  +
Sbjct:   43 LLRVASVACGIQFGWALQLSLLTPYVQELGIPHAWASVIWLCGPLSGLFVQPLVGHSSDRCTSKYGRRRPFIVAGAVAISISVMVIGHAADIGWAFGDR-EGKIKPRAIVAFVLGFWILDVANNMTQGPCRALLADLTENDNRRTRVANGYFSLFMAVGNVLGYATGSYNGWYKIFTFTKTVACNVECANLKSAFYIDVVFI 243          
BLAST of EY659559 vs. ExPASy Swiss-Prot
Match: SUT2_ORYSJ (Sucrose transport protein 2 OS=Oryza sativa subsp. japonica GN=SUT2 PE=2 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 2.987e-55
Identity = 106/208 (50.96%), Postives = 141/208 (67.79%), Query Frame = 3
Query:  126 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDT---CKSRFGRRRPXXXXXXXXXXXXXXXXXYAADICHSAGDSVTD-SVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSRSSNKITRTANSXFSFFMAVGNVLGYAXGSYTHLYHMLPFTKSKACDVYCAKLKTWLFLSIALLI 737
            K++  AS+A GVQFGWALQLSLLTPYVQ LGIPH ++SL+WLCGP+SG++VQP+VG  SD      S  GRRRP                 ++AD+    GDS+T  S +  AII++++GFW+LDV NN  QGPCRA LADL+ +  + TR AN+ FS FMA+GN+LGYA G+Y+  Y + PFT + +C + CA LK+   L I +L+
Sbjct:   26 KLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWLCGPLSGLLVQPLVGHLSDRIAPAASPLGRRRPFIAAGAASIAAAVLTVGFSADLGRIFGDSITPGSTRLGAIIVYLVGFWLLDVGNNATQGPCRAFLADLTENDPRRTRIANAYFSLFMALGNILGYATGAYSGWYKIFPFTVTPSCSISCANLKSAFLLDIIILV 233          
The following BLAST results are available for this feature:
BLAST of EY659559 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
SUC1_ARATH1.331e-7965.20Sucrose transport protein SUC1 OS=Arabidopsis thal... [more]
SUC5_ARATH2.271e-7968.57Sucrose transport protein SUC5 OS=Arabidopsis thal... [more]
SUC2_ARATH3.873e-7956.83Sucrose transport protein SUC2 OS=Arabidopsis thal... [more]
SUC6_ARATH4.283e-7866.83Putative sucrose transport protein SUC6 OS=Arabido... [more]
SUC8_ARATH1.055e-7666.02Sucrose transport protein SUC8 OS=Arabidopsis thal... [more]
SUC7_ARATH1.166e-7565.05Putative sucrose transport protein SUC7 OS=Arabido... [more]
SUC9_ARATH1.523e-7557.41Sucrose transport protein SUC9 OS=Arabidopsis thal... [more]
SUT_SPIOL9.241e-7364.56Sucrose transport protein OS=Spinacia oleracea PE=... [more]
SUC4_ARATH9.585e-6256.93Sucrose transport protein SUC4 OS=Arabidopsis thal... [more]
SUT2_ORYSJ2.987e-5550.96Sucrose transport protein 2 OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-011-E05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659559 ID=EY659559|Name=EY659559|organism=Citrus sinensis|type=EST|length=918bp
GTAGCTTATTTAGTTGGCTGGCCATGGAGAGTACCGAAGCAGGCGCAGCT
GCAGCAGCACCAACAAAGAATCAATCCTCAATTGAGTTACGGCAGCCACC
ACCTCCGCCGTCGTCCCCGATGTGGAAGATCGTAATGGTGGCGTCCATAG
CAGCGGGGGTGCAATTCGGGTGGGCCCTGCAGCTCTCTCTTTTGACCCCC
TACGTTCAGCTCCTGGGCATCCCTCACAAATGGTCTTCCCTCATTTGGCT
CTGCGGCCCCATCTCCGGCATGATCGTCCAGCCCATCGTCGGCTTCCACA
GCGACACCTGCAAATCCCGCTTCGGCCGTCGCCGCCCCTTCATTCTCGCC
GGCGCCGTCCTCGTCGCCATCGCTGTGTTTCTCATCGGCTACGCCGCCGA
CATATGCCACTCCGCGGGCGACTCCGTTACCGATTCCGTCAAAACCCGCG
CCATCATCATCTTCGTCATCGGCTTCTGGATTCTCGACGTTGCGAATAAC
ACATTACAAGGCCCATGCAGAGCCCTCCTCGCCGATCTCTCCCGCAGCAG
CAACAAGATAACAAGAACCGCAAACTCTNTTTTCTCCTTCTTCATGGCCG
TCGGTAACGTGCTTGGCTATGCCGNCGGCTCCTACACTCACTTGTACCAC
ATGCTTCCGTTCACAAAGTCAAAAGCTTGCGACGTTTACTGTGCAAAATT
GAAAACGTGGCTCTTTCTCTCCATAGCTCTGCTAATAACCCTACGACATA
GCACTGGTTTACGTGACTGAGCAAAGATTAAAAGAGATTGATGATTAAGG
AACGCGGCCGTCCACAATGATCCATTTTTCAGCGAGATTTTGTTGCATTG
AAAGGTTGCAAAAGCTATGTGGTCCTACTGCGGGGACACGGTGAACTGGA
TGCATGGTCCNGTTTCTG
back to top