EY659502

Overview
NameEY659502
Unique NameEY659502
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length917
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5467 contig Csv1_Contig5467:18..935. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: CNNM2_RAT (Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.771e-15
Identity = 50/136 (36.76%), Postives = 73/136 (53.68%), Query Frame = 2
Query:   50 DLTDDATTIIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGNPTNIIGLILVKNLLSVDYRDAVPLR---KMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKDLNEKKEGELF 448
            DL  +   II GALEL  KT +D MTP+   F             + I+  G++R+PV+ G  +NI+ L+ VK+L  VD  D  PL+   K     +  V  D  L  +L EF+KG SH+A+V + +N + EG+ F
Sbjct:  426 DLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQR-VNNEGEGDPF 560          
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: CNNM2_MOUSE (Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.771e-15
Identity = 50/136 (36.76%), Postives = 73/136 (53.68%), Query Frame = 2
Query:   50 DLTDDATTIIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGNPTNIIGLILVKNLLSVDYRDAVPLR---KMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKDLNEKKEGELF 448
            DL  +   II GALEL  KT +D MTP+   F             + I+  G++R+PV+ G  +NI+ L+ VK+L  VD  D  PL+   K     +  V  D  L  +L EF+KG SH+A+V + +N + EG+ F
Sbjct:  426 DLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQR-VNNEGEGDPF 560          
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: CNNM2_HUMAN (Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=2 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.771e-15
Identity = 50/136 (36.76%), Postives = 73/136 (53.68%), Query Frame = 2
Query:   50 DLTDDATTIIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGNPTNIIGLILVKNLLSVDYRDAVPLR---KMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKDLNEKKEGELF 448
            DL  +   II GALEL  KT +D MTP+   F             + I+  G++R+PV+ G  +NI+ L+ VK+L  VD  D  PL+   K     +  V  D  L  +L EF+KG SH+A+V + +N + EG+ F
Sbjct:  426 DLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQR-VNNEGEGDPF 560          
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: MAM3_YEAST (Protein MAM3 OS=Saccharomyces cerevisiae GN=MAM3 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.363e-14
Identity = 43/123 (34.96%), Postives = 65/123 (52.85%), Query Frame = 2
Query:   53 LTDDATTIIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGN-PTNIIGLILVKNLLSVDYRDAVPLRKMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKD 418
            LT D  TII+  L+L  K  ++ MTPI   F+              I   G SR+P++  N P N IG++LV+ L+S D  D +P+    +  +P  S +    +ILN FQ+G +H+ VV K+
Sbjct:  236 LTKDEVTIISAVLDLKAKRVEEIMTPIENVFTMSADTILDDKTVEKIFNSGFSRIPIFLPNEPNNFIGMLLVRVLISYDPDDCLPISHFPLATLPETSPNTSCLNILNYFQEGKAHMCVVSKE 358          
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: CNNM4_XENTR (Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.165e-13
Identity = 46/128 (35.94%), Postives = 68/128 (53.12%), Query Frame = 2
Query:   74 IIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGNPTNIIGLILVKNLLSVDYRDAVPL---RKMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKDLNEKKEGELF 448
            II GALEL  KT +D MT +   F             ++I+  G++R+PVY    +NI+ ++ VK+L  VD  D  PL    +     +  V  D  L  +L EF+KG SH+A+V K +N + EG+ F
Sbjct:  358 IIQGALELRTKTVEDVMTKVEDCFMLPSDAVLDFNTMSSIMESGYTRIPVYENERSNIVDILYVKDLAFVDPDDCTPLSTITRFYSHPLHFVFSDTKLDAVLEEFKKGKSHLAIVQK-VNSEGEGDPF 484          
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: CNNM1_MOUSE (Metal transporter CNNM1 OS=Mus musculus GN=Cnnm1 PE=1 SV=4)

HSP 1 Score: 76.6406 bits (187), Expect = 2.165e-13
Identity = 48/137 (35.04%), Postives = 72/137 (52.55%), Query Frame = 2
Query:   50 DLTDDATTIIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGNPT-NIIGLILVKNLLSVDYRDAVPL---RKMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKDLNEKKEGELF 448
            DL  +   II GALEL  K  ++ +TP+   F             + IL  G++R+PVY G+   NI+ ++ VK+L  VD  D  PL    +   R +  V  D  L  +L EF+KG SH+A+V + +N + EG+ F
Sbjct:  338 DLVKEELNIIQGALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILFVKDLAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQR-VNNEGEGDPF 473          
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: CNNM1_HUMAN (Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 2.165e-13
Identity = 48/137 (35.04%), Postives = 72/137 (52.55%), Query Frame = 2
Query:   50 DLTDDATTIIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGNPT-NIIGLILVKNLLSVDYRDAVPL---RKMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKDLNEKKEGELF 448
            DL  +   II GALEL  K  ++ +TP+   F             + IL  G++R+PVY G+   NI+ ++ VK+L  VD  D  PL    +   R +  V  D  L  +L EF+KG SH+A+V + +N + EG+ F
Sbjct:  338 DLVKEELNIIQGALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILFVKDLAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQR-VNNEGEGDPF 473          
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: CNNM4_HUMAN (Metal transporter CNNM4 OS=Homo sapiens GN=CNNM4 PE=1 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 2.828e-13
Identity = 46/136 (33.82%), Postives = 71/136 (52.21%), Query Frame = 2
Query:   50 DLTDDATTIIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGNPTNIIGLILVKNLLSVDYRDAVPLR---KMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKDLNEKKEGELF 448
            DL  +   +I GALEL  KT +D MT +   F             + I+  G++R+PV+    +NI+ ++ VK+L  VD  D  PL+   +     +  V  D  L  +L EF+KG SH+A+V K +N + EG+ F
Sbjct:  353 DLVKEELNMIQGALELRTKTVEDIMTQLQDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVDILYVKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQK-VNNEGEGDPF 487          
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: CNNM4_RAT (Metal transporter CNNM4 OS=Rattus norvegicus GN=Cnnm4 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.693e-13
Identity = 46/136 (33.82%), Postives = 71/136 (52.21%), Query Frame = 2
Query:   50 DLTDDATTIIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGNPTNIIGLILVKNLLSVDYRDAVPLR---KMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKDLNEKKEGELF 448
            DL  +   +I GALEL  KT +D MT +   F             + I+  G++R+PV+    +NI+ ++ VK+L  VD  D  PL+   +     +  V  D  L  +L EF+KG SH+A+V K +N + EG+ F
Sbjct:  351 DLVKEELNMIQGALELRTKTVEDIMTQLHDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVDILYVKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQK-VNNEGEGDPF 485          
BLAST of EY659502 vs. ExPASy Swiss-Prot
Match: CNNM4_MOUSE (Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 3.693e-13
Identity = 46/136 (33.82%), Postives = 71/136 (52.21%), Query Frame = 2
Query:   50 DLTDDATTIIAGALELTEKTAKDAMTPISKAFSXXXXXXXXXXXXNAILFMGHSRVPVYSGNPTNIIGLILVKNLLSVDYRDAVPLR---KMIIRRIPRVSEDMPLYDILNEFQKGHSHIAVVYKDLNEKKEGELF 448
            DL  +   +I GALEL  KT +D MT +   F             + I+  G++R+PV+    +NI+ ++ VK+L  VD  D  PL+   +     +  V  D  L  +L EF+KG SH+A+V K +N + EG+ F
Sbjct:  350 DLVKEELNMIQGALELRTKTVEDIMTQLHDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVDILYVKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQK-VNNEGEGDPF 484          
The following BLAST results are available for this feature:
BLAST of EY659502 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
CNNM2_RAT1.771e-1536.76Metal transporter CNNM2 OS=Rattus norvegicus GN=Cn... [more]
CNNM2_MOUSE1.771e-1536.76Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 P... [more]
CNNM2_HUMAN1.771e-1536.76Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 P... [more]
MAM3_YEAST4.363e-1434.96Protein MAM3 OS=Saccharomyces cerevisiae GN=MAM3 P... [more]
CNNM4_XENTR2.165e-1335.94Metal transporter CNNM4 OS=Xenopus tropicalis GN=c... [more]
CNNM1_MOUSE2.165e-1335.04Metal transporter CNNM1 OS=Mus musculus GN=Cnnm1 P... [more]
CNNM1_HUMAN2.165e-1335.04Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 P... [more]
CNNM4_HUMAN2.828e-1333.82Metal transporter CNNM4 OS=Homo sapiens GN=CNNM4 P... [more]
CNNM4_RAT3.693e-1333.82Metal transporter CNNM4 OS=Rattus norvegicus GN=Cn... [more]
CNNM4_MOUSE3.693e-1333.82Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-H01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659502 ID=EY659502|Name=EY659502|organism=Citrus sinensis|type=EST|length=917bp
CCGGNATTACAGACCCCGACCCACGCGTCCGNGAGCTGGTAATGGTGGGG
ATCTAACTGATGATGCGACTACTATCATCGCTGGAGCTCTGGAGTTGACT
GAAAAAACTGCAAAAGATGCCATGACTCCCATATCGAAGGCATTTTCTCT
TGATCTGGATGCAACACTTACTTTGGATACCTTAAATGCCATATTGTTCA
TGGGTCATAGTAGAGTTCCTGTTTACTCTGGGAATCCGACAAATATAATT
GGCCTCATTCTGGTTAAAAATCTTTTATCAGTCGATTATAGAGATGCAGT
TCCTTTGCGGAAAATGATCATACGGAGAATACCACGGGTTTCAGAAGACA
TGCCTTTGTATGATATTCTAAATGAATTTCAGAAAGGACATAGCCACATT
GCTGTTGTATATAAGGATCTAAATGAGAAAAAAGAGGGTGAGCTTTTTAA
GGACAATTGTAAGAAGCCAAGAGGACAACCTGAGAAATCATCTGAAAAAG
TTGATAATGGGGTTACTGCTGCTGGCCAGAATTTGCGGAATAAATTGGAA
TCAAAAGATGCTCAACAGACTAAGAAAGTTCCACCAGCTACTCCTACCTT
TAATAAGCGACACAGATGTTGNTCGTACTGCATTCTCGACATTGAGAATG
GTCCTTTTCCAGATTTTCCATCCAATGAGGAAGCCCGAGGTGTTATTACC
ATGGAGGATGTCTTTGAAGAACTTCTTCGGAAGAAATTCTGGGTGAAACC
CATGAATATGTCACCATTCACCACCGGATAAAAAGAAACATGCATGCCTT
CCAGGAAAGTCTCAAAATCCGGATAATACATCACAACCCTTTCTGAATGG
AAAATTTGCCTTTAAACATTTGCAGGCTAACCTTCCTTGGAGGACTTTGG
GCTCGAACCACTTTTCC
back to top