EY659414

Overview
NameEY659414
Unique NameEY659414
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length822
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12425 contig Csv1_Contig12425:54..877. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS_LACSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Lactuca sativa GN=RBCS PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.660e-81
Identity = 136/177 (76.84%), Postives = 156/177 (88.14%), Query Frame = 3
Query:   54 ISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPGV 584
            ISS+ +AT NR +  QAS+ APFTGLKS+ AFP TKK NND +S+ SNGGRVQCMKVWPP GLKK+ETLSYLPPLSDEAL KEI YL+R+ WIPCLEFELE G+VYREHH SPGYYDGRYWTMWKLPM+GCTD+ QV+KEVGE +KEYP++F+R+IGFDN RQVQCISF+ AKPPGV
Sbjct:    4 ISSSAIATVNRTTSTQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPPGV 180          
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS_FAGCR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Fagus crenata GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 1.118e-79
Identity = 140/180 (77.78%), Postives = 159/180 (88.33%), Query Frame = 3
Query:   39 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 578
            MASSMISS TVAT +RA+ AQA+MVAPFTGLKS++AFPAT+K+NNDITS+ASNGGRVQCMKVWPP GL+KFETLSYLPPLS E+L K+I YL+  GWIPCLEFELE  +VYRE++ SPGYYDGRYW MWKLPM+GCTDATQVL E+ E  K YP S +RIIGFDNKRQVQCISF+A KPP
Sbjct:    1 MASSMISSATVATVSRATPAQATMVAPFTGLKSTAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180          
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS_BETVE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Betula verrucosa GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 1.118e-79
Identity = 142/182 (78.02%), Postives = 158/182 (86.81%), Query Frame = 3
Query:   39 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPGV 584
            MA SMISS TVA  +RAS AQ+SMVAPFT LKS+SAFP T+KTNNDITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E L KE+ YLLR   IPCLEFELE G+VYREH+ SPGYYDGRYWTMWKLPM+GC D++QVLKE+ E +K YP +F+RIIGFDNKRQVQ ISF+A KPPGV
Sbjct:    1 MACSMISSATVAAVSRASPAQSSMVAPFTCLKSTSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAFIRIIGFDNKRQVQIISFIAYKPPGV 182          
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS_PYRPY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Pyrus pyrifolia GN=RBCS PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.614e-78
Identity = 142/183 (77.60%), Postives = 159/183 (86.89%), Query Frame = 3
Query:   39 MASSMISSTTVAT--ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 581
            MASSMISS TVAT  A+R + AQA MVAPF GLKSSSAFP T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE+ YLLR  W+PCLEFELE G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISF+A KP G
Sbjct:    1 MASSMISSGTVATVSADRPAPAQARMVAPFNGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS_MALSP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Malus sp. GN=RBCS PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 4.696e-78
Identity = 142/183 (77.60%), Postives = 159/183 (86.89%), Query Frame = 3
Query:   39 MASSMISSTTVAT--ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 581
            MASSMISS TVAT  A+R + AQA MVAPFTGLKSSSA P T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE+ YLLR  W+PCLEFELE G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISF+A KP G
Sbjct:    1 MASSMISSGTVATVSADRPAPAQARMVAPFTGLKSSSASPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS_MANES (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Manihot esculenta PE=2 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.784e-77
Identity = 136/181 (75.14%), Postives = 152/181 (83.98%), Query Frame = 3
Query:   39 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 581
            MASSM+S+ TVA+ NR S AQA+MVAPFTGLKS+  FP T+KTN+DITSI SNGG+VQCMKVWP  G+KKFETLSYLPPL+ E L  E+ YLLRSGWIPCLEFELE G VYREH   PGYYDGRYWTMWKLPM+GCTDA QVLKE+ E+ K +P  + RIIGFDN RQVQCISFLA KPPG
Sbjct:    1 MASSMLSTATVASINRVSPAQATMVAPFTGLKSTPVFPTTRKTNSDITSITSNGGKVQCMKVWPTLGMKKFETLSYLPPLTREQLASEVEYLLRSGWIPCLEFELEHGLVYREHARVPGYYDGRYWTMWKLPMFGCTDAAQVLKELDELIKHHPDGYARIIGFDNVRQVQCISFLAYKPPG 181          
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS_MEDSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.975e-77
Identity = 131/176 (74.43%), Postives = 153/176 (86.93%), Query Frame = 3
Query:   48 SMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 575
            ++ISS  V T NRAS AQA++VAPFTGLKSS+ FP TKKTNNDITSIASNGGRV CM+VWPP G KKFETLSYLPPL++E L KE+ YL+R GWIPCLEFELEKG+VYRE+H SPGYYDGRYWTMW+LP++G TD++QVLKE+ + + EYP SF+RIIGFDN RQVQCISF+A  P
Sbjct:    2 ALISSAAVTTVNRASSAQANLVAPFTGLKSSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLEFELEKGFVYRENHRSPGYYDGRYWTMWRLPLFGATDSSQVLKELADCKAEYPDSFIRIIGFDNVRQVQCISFIAHTP 177          
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS_HEVBR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Hevea brasiliensis GN=RBCS PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 5.192e-77
Identity = 137/181 (75.69%), Postives = 152/181 (83.98%), Query Frame = 3
Query:   39 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 581
            MASSM+S+  VA  NRAS AQASMVAPFTGLKS+SAFP T+KT  DITSIASNGGRVQCM+VWPP G K +ETLSYLPPL+ E L KE+ YLLR GW+PCLEFELE G VYRE+H SPGYYDGRYWTMWKLPM+GCTDA QVL+E+ E+ K YP  + RIIGFDN RQVQCISFLA KP G
Sbjct:    1 MASSMLSTAAVACINRASPAQASMVAPFTGLKSTSAFPTTRKTTTDITSIASNGGRVQCMQVWPPRGKKFYETLSYLPPLTREQLAKEVEYLLRKGWVPCLEFELEHGTVYREYHRSPGYYDGRYWTMWKLPMFGCTDAVQVLQELDEMIKAYPDCYGRIIGFDNVRQVQCISFLAYKPKG 181          
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS3_SOLTU (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Solanum tuberosum GN=RBCS-3 PE=3 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.973e-76
Identity = 134/182 (73.63%), Postives = 159/182 (87.36%), Query Frame = 3
Query:   39 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNN-DITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 581
            MASS++SS  VAT  R+++AQASMVAPFTGLKS+++FP TKK NN DITS+ASNGGRV+CM+VWPP  +KK+ETLSYLP LSDE LLKE+ YLL++GW+PCLEFE E G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:    1 MASSIVSSAAVAT--RSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of EY659414 vs. ExPASy Swiss-Prot
Match: RBS3B_ARATH (Ribulose bisphosphate carboxylase small chain 3B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-3B PE=1 SV=2)

HSP 1 Score: 285.034 bits (728), Expect = 3.365e-76
Identity = 136/180 (75.56%), Postives = 153/180 (85.00%), Query Frame = 3
Query:   39 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 578
            MASSM+SS  V T    S AQA+MVAPFTGLKSS+AFP T+KTN DITSIASNGGRV CMKVWPP G KKFETLSYLP LSD  L KE+ YLLR+ WIPC+EFELE G+VYREH ++PGYYDGRYWTMWKLP++GCTD+ QVLKEV E +KEYP +F+RIIGFDN RQVQCISF+A KPP
Sbjct:    1 MASSMLSSAAVVT----SPAQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176          
The following BLAST results are available for this feature:
BLAST of EY659414 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
RBS_LACSA2.660e-8176.84Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_FAGCR1.118e-7977.78Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_BETVE1.118e-7978.02Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_PYRPY1.614e-7877.60Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MALSP4.696e-7877.60Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MANES1.784e-7775.14Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MEDSA3.975e-7774.43Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_HEVBR5.192e-7775.69Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS3_SOLTU1.973e-7673.63Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS3B_ARATH3.365e-7675.56Ribulose bisphosphate carboxylase small chain 3B, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-H04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659414 ID=EY659414|Name=EY659414|organism=Citrus sinensis|type=EST|length=822bp
CCACGCGTCCGCAAAGCTAGAAGAAGGAGCAAGTACCAATGGCTTCCTCA
ATGATCTCATCGACCACCGTTGCCACCGCGAACCGCGCCAGCCTTGCTCA
GGCCAGCATGGTCGCCCCCTTCACCGGCCTCAAGTCTTCTTCTGCTTTCC
CAGCAACCAAGAAGACCAACAATGACATTACTTCCATTGCAAGCAACGGC
GGAAGAGTCCAATGCATGAAGGTGTGGCCACCAACTGGCTTGAAGAAGTT
CGAGACTCTCTCATACCTCCCGCCACTGTCCGATGAAGCTTTGCTCAAGG
AAATCAGTTACCTTCTCCGCTCCGGCTGGATTCCCTGCTTGGAATTCGAG
TTGGAGAAAGGATGGGTGTACCGTGAGCACCACAGCTCACCAGGATACTA
CGATGGACGCTACTGGACAATGTGGAAGCTGCCCATGTATGGGTGCACAG
ATGCAACCCAGGTTTTGAAGGAGGTTGGGGAGGTCCAGAAGGAATACCCA
CATTCATTCGTCCGAATTATCGGATTTGACAACAAGCGTCAAGTGCAGTG
CATCAGTTTCCTTGCTGCCAAGCCACCAGGCGTCTAGGTTCCCAATTAAA
TTTGTGTAACCACCCATGCAATATTGTTGATTATTATTATGTGTAACCCC
CATAATGATCATTCGATCAATGGGGGTTCGGTTTGCGTTTAATTTGTACT
TANGCTGCTGTTGCTGCTGCTCAAACTTTTTTGGTTTTCTCCCCGACTTT
GGCTTTTTTTTTTATATATAATTTAAAAAATGAATCCTTNGTTTTCAGTT
TCATTAAAAAAAAAAAAAAAAA
back to top