EY659392

Overview
NameEY659392
Unique NameEY659392
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length923
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659392 vs. ExPASy Swiss-Prot
Match: IF3_SYNP2 (Translation initiation factor IF-3 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=infC PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.650e-11
Identity = 33/79 (41.77%), Postives = 51/79 (64.56%), Query Frame = 3
Query:  483 YNIDQHDYSVRLKAARKFLKDGDKVKVIVNLKGRENEFRNIAIELIRRFQNDVGELA-IEENKKFRDRNIFYILVPNKA 716
            Y I++HDY VR+ +A++FLK GDKVK  +  +GRE +  N+A +L+ R   D+ E+  I++  K   RN+  IL P K+
Sbjct:   99 YKIEEHDYQVRVNSAQRFLKSGDKVKATITFRGREIQHSNLAQKLLDRMAKDLEEVGEIQQRPKREGRNMMMILAPKKS 177          
BLAST of EY659392 vs. ExPASy Swiss-Prot
Match: IF3_MICAN (Translation initiation factor IF-3 OS=Microcystis aeruginosa (strain NIES-843) GN=infC PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.519e-11
Identity = 33/78 (42.31%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  483 YNIDQHDYSVRLKAARKFLKDGDKVKVIVNLKGRENEFRNIAIELIRRFQNDVGELA-IEENKKFRDRNIFYILVPNK 713
            Y ID+HDY+VR+  A++FLK GDKVK  +  +GRE +  N+A EL+ R   D+ ++A +++  K   RN+  +L P K
Sbjct:   99 YKIDEHDYNVRVNQAQRFLKAGDKVKATITFRGREIQHSNLAEELLARMAKDLQDVAEVQQAPKKEGRNMMMMLSPKK 176          
BLAST of EY659392 vs. ExPASy Swiss-Prot
Match: IF3_THETN (Translation initiation factor IF-3 OS=Thermoanaerobacter tengcongensis GN=infC PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.903e-11
Identity = 33/79 (41.77%), Postives = 51/79 (64.56%), Query Frame = 3
Query:  480 SYNIDQHDYSVRLKAARKFLKDGDKVKVIVNLKGRENEFRNIAIELIRRFQNDVGELA-IEENKKFRDRNIFYILVPNK 713
            S NI+ HD+ V+LK+A KFLKDGDKVKV +  +GRE    ++A +L++RF  ++ E   +E+      RN+  ++ P K
Sbjct:  101 SPNIEDHDFGVKLKSAIKFLKDGDKVKVTIRFRGREAAHTSLAEDLLKRFAEELREYGNVEKAPSMDGRNMMMVIAPKK 179          
BLAST of EY659392 vs. ExPASy Swiss-Prot
Match: IF3_SYNY3 (Translation initiation factor IF-3 OS=Synechocystis sp. (strain PCC 6803) GN=infC PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.903e-11
Identity = 35/78 (44.87%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  483 YNIDQHDYSVRLKAARKFLKDGDKVKVIVNLKGRENEFRNIAIELIRRFQNDVG-ELAIEENKKFRDRNIFYILVPNK 713
            Y ID+HDY VR+  A++FLK GDKVK  VN +GRE +  ++A EL+ R   D+  E  I++  K   RN+   L P K
Sbjct:   99 YKIDEHDYQVRINQAKRFLKAGDKVKATVNFRGREIQHAHLAKELLDRMATDLATEADIQQAPKREGRNMMMFLSPKK 176          
BLAST of EY659392 vs. ExPASy Swiss-Prot
Match: IF3C_CYAME (Translation initiation factor IF-3, chloroplastic OS=Cyanidioschyzon merolae GN=infC PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.903e-11
Identity = 38/80 (47.50%), Postives = 50/80 (62.50%), Query Frame = 3
Query:  480 SYNIDQHDYSVRLKAARKFLKDGDKVKVIVNLKGRENEFRNIAIELIRRFQNDVGELA-IEENKKFRDRNIFYILVPNKA 716
            SYN+++HDY VRL  A KFLK GDKVKV + LKGRE +   +A   + +FQ DV  LA + +      RN+  I VP K+
Sbjct:   96 SYNMEEHDYQVRLSQACKFLKAGDKVKVTLMLKGREMQHLELAQNKMAQFQADVSSLAQLAKPPSQEGRNLSAIFVPKKS 175          
The following BLAST results are available for this feature:
BLAST of EY659392 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
IF3_SYNP22.650e-1141.77Translation initiation factor IF-3 OS=Synechococcu... [more]
IF3_MICAN4.519e-1142.31Translation initiation factor IF-3 OS=Microcystis ... [more]
IF3_THETN5.903e-1141.77Translation initiation factor IF-3 OS=Thermoanaero... [more]
IF3_SYNY35.903e-1144.87Translation initiation factor IF-3 OS=Synechocysti... [more]
IF3C_CYAME5.903e-1147.50Translation initiation factor IF-3, chloroplastic ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-F06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659392 ID=EY659392|Name=EY659392|organism=Citrus sinensis|type=EST|length=923bp
CCACGCGTCCGTAAATGTTAGCCAATCGGATGGATTTGAAGGAACTTAAA
ATGGGGTAAGTTTGTTGATGCATTTACTTTTCTCCAATTTCAGAGAGAAC
TCTTTGGTTTGTTTTTGAGTTTTGATGCCTAAGTTGTTGGTGGCTTATTA
AACAACTGTTTCTGATGGCACAACGTTTAATTTTGCATATGAATATTTTC
CAAAATCATCACAATCCTGTTTATCTGCATGATTCAAATATCAAATTTTG
ATTTCCTCCATTATCTTAGATTTTTTGAGATGGTTTTTGTGTCAATGTTA
CAGTTTACACTAGTGAAGTTACTAACTTTGAAAATTCAACAAGTAGTGTT
GAATGTGGGTGGGTCTGTATATATGTTTCTCAGTGACCATTCCAGTCAAG
ATTGTTATTCAAATTTCTGAAGCTATAACATTCTTATATCTAAGTTATGG
TTTTACTTGTTATGTTTAATTCTGTTGACAGTTATAATATTGACCAGCAT
GATTATTCTGTGCGTCTAAAAGCTGCAAGGAAGTTTCTGAAAGATGGAGA
CAAGGTTAAGGTCATAGTGAACCTCAAAGGGCGGGAAAATGAATTCAGAA
ATATTGCTATTGAGCTAATACGACGTTTCCAGAATGATGTTGGGGAGCTT
GCTATTGAGGAGAACAAAAAATTCAGAGATAGGAATATATTTTATATTTT
AGTTCCCAATAAGGCCCTCTCACAGAAGGCTCAAGAACCACCCGAGAAAG
AAGATTAACAAGTTGTAGATGAAGTCTNCACTGGTGTCTGANTGCATTCA
GCCATTCCNAGTGGGGTTTTTGACACATAACAAATTGGCCGGTAATCCTA
TATGTGCCTTTCGACTGGGATGTGTTGAATTCGGGTATAGAATAAGGGGG
TACAGCTGGGGGGCATATTATTA
back to top