EY659308

Overview
NameEY659308
Unique NameEY659308
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length892
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659308 vs. ExPASy Swiss-Prot
Match: RSBQ_BACSU (Sigma factor sigB regulation protein rsbQ OS=Bacillus subtilis GN=rsbQ PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 8.341e-47
Identity = 98/226 (43.36%), Postives = 137/226 (60.62%), Query Frame = 1
Query:   58 HNVKVTGSGEQVIVLAHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFNRYSTLEGYALDLLAILEELQIDSCILVGHSVSAMIGAIASISRPDLFTKLVMISGSPRYLND-VDYYGGFEQEELDQLFEAMRSNYKAWCSGFAPLAVGGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRXILGLVSVPCHIIQSVKDLAVPVXISRYLHQNL 732
            ++VKV GSG+  I+ A GFG DQSVW  + P   +D+RV+L+D +G+G ++   +D NRY TL+GYA D+L + E L +   + VGHSV A+IG +ASI RP+LF+ LVM+  SP YLND  +YYGGFE+E+L  L E M  NY  W + FA   +         +E      +  P IA   A+  F SD R  L  V+VP  I+Q   D+  P  + +Y+HQ+L
Sbjct:    9 NHVKVKGSGKASIMFAPGFGCDQSVWNAVAPAFEEDHRVILFDYVGSGHSDLRAYDLNRYQTLDGYAQDVLDVCEALDLKETVFVGHSVGALIGMLASIRRPELFSHLVMVGPSPCYLNDPPEYYGGFEEEQLLGLLEMMEKNYIGWATVFAATVLNQPDRPEIKEELESRFCSTDPVIARQFAKAAFFSDHREDLSKVTVPSLILQCADDIIAPATVGKYMHQHL 234          
The following BLAST results are available for this feature:
BLAST of EY659308 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
RSBQ_BACSU8.341e-4743.36Sigma factor sigB regulation protein rsbQ OS=Bacil... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-F12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659308 ID=EY659308|Name=EY659308|organism=Citrus sinensis|type=EST|length=892bp
AAAGAAAAAAAGCTCCGCAGATTCAGGCGAGGCGAAATGGGAATCGTGGA
AGAAGCTCACAACGTGAAAGTGACGGGGTCAGGGGAGCAAGTGATAGTGT
TGGCTCACGGCTTCGGCACCGACCAGTCGGTGTGGAAGCACCTCGTGCCT
CATCTCGTCGACGATTACCGCGTCGTTTTGTATGACAACATGGGCGCTGG
CACCACCAATCCCGACTACTTTGACTTCAACAGATACTCCACCCTCGAAG
GCTATGCCCTTGATTTGCTTGCTATTTTAGAAGAGCTGCAAATTGACTCT
TGTATTCTCGTCGGTCACTCTGTTTCCGCCATGATTGGCGCCATCGCCTC
CATCTCCCGCCCTGATCTCTTCACTAAACTCGTCATGATCTCCGGCTCTC
CCAGGTATCTCAATGATGTGGATTACTACGGAGGATTTGAGCAAGAGGAG
CTGGATCAGCTTTTTGAAGCAATGAGGTCAAATTACAAGGCATGGTGCTC
TGGATTCGCCCCGCTAGCTGTCGGCGGGGACATGGACTCGGTGGCTGTTC
AAGAATTTAGCCGAACCTTATTCAACATGAGACCAGACATAGCCTTGAGT
GTGGCACAAACCATTTTCCAAAGTGACATGAGGCANATTCTCGGCCTTGT
CAGTGTCCCATGCCACATAATACAAAGCGTGAAGGATTTGGCCGTGCCTG
TANTGATCTCCCGATATCTTCATCAGAATCTNNCTCGTGATTNCCGTNGN
TGAAGTCATGTCATCTGACGGTCATTTGCCGCAGCTGAGCTCCCCGGATA
TGTAATTTCCGTGCTTCTTAGCACTTCGCTACATATTGATATGATTGGAA
GGGGTTTATGTTTACGACTCTGGGGGTTTTTTCTTGNATTNG
back to top