EY659301

Overview
NameEY659301
Unique NameEY659301
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length924
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3764 contig Csv1_Contig3764:427..1349. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: ASO_TOBAC (L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.542e-94
Identity = 146/210 (69.52%), Postives = 168/210 (80.00%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTTNQDPSYNYWISAGVRGRKPATPPALTLLNYHPTSASKIPLSPPPITPRWDDYDHSKSFSNKIFALMGSPKPPTNFHRRLTLLNTQNTINGFTKWAINNVSLTLPPTPYLGSIKYGLKDAFDQNGPPENFSNEYDVMKPPVNANTTLGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            YVQPF V DMDIYSGESYSVL  T+QDP+ NYWIS  VRGR+P TP  LTLLNY P SASK P  PPPI P W+DY+HSKSFSNKIFALMGSPKPP   HRR+ LLNTQN I+G+TKWAINNVSL LP   YLGSI+YG+ +AFD   PP+NF  +YDV+K   N+N+T G+GVYML  NTT+D+ILQNA A+  ++SE HPWHLHGHDF
Sbjct:  273 YVQPFSVQDMDIYSGESYSVLFKTDQDPTKNYWISINVRGREPKTPQGLTLLNYLPNSASKFPTLPPPIAPLWNDYNHSKSFSNKIFALMGSPKPPPQNHRRIILLNTQNKIDGYTKWAINNVSLVLPTQLYLGSIRYGI-NAFDTKPPPDNFPKDYDVLKQAPNSNSTYGNGVYMLKFNTTIDIILQNANALAKDVSEIHPWHLHGHDF 481          

HSP 2 Score: 56.225 bits (134), Expect = 3.542e-94
Identity = 35/93 (37.63%), Postives = 42/93 (45.16%), Query Frame = 1
Query:  622 GMIFXVLGAREGKVTKEDEXXXXXXXXXXXXTGVIFPYGWTALRIXADNPXAWGXXXXXXXXXXMEWVVVLALGVE-PXVISKPSVAWGXLGK 897
            G  F VLG  EGK +++D             T VIFP+GWTALR   DNP  W           M   V+ A GV     I K ++A G  GK
Sbjct:  478 GHDFWVLGYGEGKFSEKDVKKFNLKNPPLRNTAVIFPFGWTALRFVTDNPGVWAFHCHIEPHLHMGMGVIFAEGVHLVKKIPKEALACGLTGK 570          
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: ASO_CUCPM (L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 2.493e-92
Identity = 139/210 (66.19%), Postives = 161/210 (76.67%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTTNQDPSYNYWISAGVRGRKPATPPALTLLNYHPTSASKIPLSPPPITPRWDDYDHSKSFSNKIFALMGSPKPPTNFHRRLTLLNTQNTINGFTKWAINNVSLTLPPTPYLGSIKYGLKDAFDQNGPPENFSNEYDVMKPPVNANTTLGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            YVQPF   D+DIYSGESYSVL+TT+Q+PS NYW+S G R R P TPP LTLLNY P S SK+P SPPP TP WDD+D SK+F+ +I A MGSPKPP  F+RR+ LLNTQN ING+ KWAIN+VSL LPPTPYLG++KY L  AFDQN PPE F  +YD+  PP N  T +G+GVY   +   VDVILQNA  +  NLSETHPWHLHGHDF
Sbjct:  245 YVQPFYTSDIDIYSGESYSVLITTDQNPSENYWVSVGTRARHPNTPPGLTLLNYLPNSVSKLPTSPPPQTPAWDDFDRSKNFTYRITAAMGSPKPPVKFNRRIFLLNTQNVINGYVKWAINDVSLALPPTPYLGAMKYNLLHAFDQNPPPEVFPEDYDIDTPPTNEKTRIGNGVYQFKIGEVVDVILQNANMMKENLSETHPWHLHGHDF 454          

HSP 2 Score: 56.9954 bits (136), Expect = 2.493e-92
Identity = 32/76 (42.11%), Postives = 36/76 (47.37%), Query Frame = 1
Query:  622 GMIFXVLGAREGKVTKEDEXXXXXXXXXXXXTGVIFPYGWTALRIXADNPXAWGXXXXXXXXXXMEWVVVLALGVE 849
            G  F VLG  +GK + E+E            T VIFPYGWTA+R  ADNP  W           M   VV A GVE
Sbjct:  451 GHDFWVLGYGDGKFSAEEESSLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVE 526          
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: ASO_CUCMA (L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2)

HSP 1 Score: 299.286 bits (765), Expect = 2.727e-91
Identity = 137/210 (65.24%), Postives = 160/210 (76.19%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTTNQDPSYNYWISAGVRGRKPATPPALTLLNYHPTSASKIPLSPPPITPRWDDYDHSKSFSNKIFALMGSPKPPTNFHRRLTLLNTQNTINGFTKWAINNVSLTLPPTPYLGSIKYGLKDAFDQNGPPENFSNEYDVMKPPVNANTTLGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            YVQPF   D+DIYSGESYSVL+TT+Q+PS NYW+S G RGR P TPP LTLLNY P S SK+P SPPP TP WDD+D SK+F+ +I A MGSPKPP   +RR+ LLNTQN ING+ KWAIN+VSL LPPTPYLG++K+ L  AFDQN PPE F  +YD+  PP N  T +G+GVY   +   VDVILQNA  +  NLSE HPWHLHGHDF
Sbjct:  275 YVQPFYTSDIDIYSGESYSVLITTDQNPSENYWVSVGTRGRHPNTPPGLTLLNYLPNSVSKLPTSPPPETPAWDDFDRSKNFTYRITAAMGSPKPPVKSNRRIFLLNTQNVINGYVKWAINDVSLALPPTPYLGAMKFNLLHAFDQNPPPEVFPEDYDIDTPPTNEKTKIGNGVYQFKIGEIVDVILQNANMMKENLSEIHPWHLHGHDF 484          

HSP 2 Score: 58.5362 bits (140), Expect = 2.727e-91
Identity = 33/76 (43.42%), Postives = 36/76 (47.37%), Query Frame = 1
Query:  622 GMIFXVLGAREGKVTKEDEXXXXXXXXXXXXTGVIFPYGWTALRIXADNPXAWGXXXXXXXXXXMEWVVVLALGVE 849
            G  F VLG  +GK T E+E            T VIFPYGWTA+R  ADNP  W           M   VV A GVE
Sbjct:  481 GHDFWVLGYGDGKFTAEEESSLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVE 556          
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: ASO_CUCSA (L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 3.557e-91
Identity = 140/210 (66.67%), Postives = 162/210 (77.14%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTTNQDPSYNYWISAGVRGRKPATPPALTLLNYHPTSASKIPLSPPPITPRWDDYDHSKSFSNKIFALMGSPKPPTNFHRRLTLLNTQNTINGFTKWAINNVSLTLPPTPYLGSIKYGLKDAFDQNGPPENFSNEYDVMKPPVNANTTLGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            YVQPF   D+DIYSGESYSVL+TT+Q+P  NYW+S GVR R P TPP LTLLNY P SASK+P+SPPP TP W+D+D SK+F+ +IFA MGSPKPP  ++RRL LLNTQN INGF KWAINNVSL LPPTPYL ++K  L  AF+QN PPE F   YD+  PP N  TT G+GVY   +  TVDVILQNA  + PN+SE HPWHLHGHDF
Sbjct:  280 YVQPFVTSDIDIYSGESYSVLITTDQNPLENYWVSIGVRARLPKTPPGLTLLNYLPNSASKLPISPPPETPHWEDFDRSKNFTFRIFAAMGSPKPPVRYNRRLFLLNTQNRINGFMKWAINNVSLALPPTPYLAAMKMRLNTAFNQNPPPETFPLNYDINNPPPNPETTTGNGVYKFNMGETVDVILQNANMLNPNMSEIHPWHLHGHDF 489          

HSP 2 Score: 52.7582 bits (125), Expect = 3.557e-91
Identity = 33/76 (43.42%), Postives = 34/76 (44.74%), Query Frame = 1
Query:  622 GMIFXVLGAREGKV-TKEDEXXXXXXXXXXXXTGVIFPYGWTALRIXADNPXAWGXXXXXXXXXXMEWVVVLALGV 846
            G  F VLG  EGK    EDE            T VIFPYGWTA+R  ADNP  W           M   VV A GV
Sbjct:  486 GHDFWVLGYGEGKFYAPEDEKKLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGV 561          
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: LAC16_ARATH (Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 2.637e-16
Identity = 68/229 (29.69%), Postives = 101/229 (44.10%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTTNQDPSYNYWISAGV---------RGRKPATPPALTLLNYHPTSASKIPLSPPPITPRWDDYDHSKSFSNKIFALMGSPKPPTNFHRRLTLL------NTQNTINGFTKWA-INNVSLTLPPTPYLGSIKYGLKDAFDQNGPPENFSNEYDVMKP---PVNANTTLGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            Y +P++ D + I  G++ +VLLT N +   NY ++A                AT   +   +   TS   +  S PP    W     ++S    + +L    + PT     L           Q+  NG    A INNV+ T+P T  L +  + +   F  + P +  SN YD   P    VNA T  G+ +Y L  N TV ++LQN   I   LS+ HP+HLHG +F
Sbjct:  253 YTKPYKTDTVFIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVATKFTRSL-RSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCNNGVRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKP-SNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMI---LSDNHPFHLHGFNF 476          

HSP 2 Score: 29.6462 bits (65), Expect = 2.637e-16
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  736 GWTALRIXADNPXAW 780
            GWTA+R  ADNP  W
Sbjct:  512 GWTAIRFIADNPGVW 526          
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: LAC22_ORYSJ (Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 5.226e-13
Identity = 66/226 (29.20%), Postives = 103/226 (45.58%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTTNQDP-----SYNYWISAGVRGRKPATPPALTLLNYHPTSASKIPLSPPPITPRWDDYDHSKSFSNKIFALMGSPKPPTNFHRRL--TLLNT--------QNTINGF-TKWAINNVSLTLPPTPYLGSIKYGLKDAFDQNGPPENFSNEYDVMKPPVNANTTLGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            Y +PF+ D + I  G++ +VL+  NQ       S + ++ A V+         L   N   +S + + L  PP  P+   +  SK F++ + +L  S + P N  + +  +LL T         + ING      INNV+  +P TP L +  Y +   F ++ P             P N  T  G+ VY L  N +V V+LQ+   I P   E+HP HLHG +F
Sbjct:  256 YTKPFKTDTLLITPGQTTNVLVRANQGAGRYLLSVSPFMDAPVQVDNKTGTATLHYANTVSSSMASLTLVKPP--PQNATHIVSK-FTDSLHSL-NSKEYPANVPQTVDHSLLLTVGVGVNPCPSCINGTRVVGTINNVTFIMPSTPILQAHYYNIPGVFTEDFPATPLHKFNYTGSGPKNLQTMNGTRVYRLPYNASVQVVLQDTGIISP---ESHPIHLHGFNF 474          

HSP 2 Score: 28.4906 bits (62), Expect = 5.226e-13
Identity = 9/15 (60.00%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  736 GWTALRIXADNPXAW 780
            GWTA+R  +DNP  W
Sbjct:  510 GWTAIRFRSDNPGVW 524          
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: LAC11_ORYSJ (Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 1.488e-12
Identity = 70/240 (29.17%), Postives = 105/240 (43.75%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTT--NQDPSYNYWISAGVRGRKPAT---PPALTLLNYH--PTSASKIPLSPPPITPRWDDYDHSKSFSNKIFALMGSPKP---PTNFHRRLTLL------NTQNTINGF------TKWA--INNVSLTLPPTPYLGS-IKYGLKDAFDQNGP-----PENFSNEYDVMKPPVNANTTLGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            YV+PF    + I  G++  VLLT   N  PS ++ I+         T     A+ +L Y+   TSA+ +   P P  P ++D     +FS    +L  +  P   P    R             Q+ +NG       T++A  +NNVS  +P T  L +  +         N P     P N++       PP N   T G+ V  L  NTTV+V+LQ+   +    +E+HP HLHG+DF
Sbjct:  218 YVKPFAATALVISPGQTMDVLLTAAANNPPSRSFAIAVAPYTNTVGTFDNTTAVAVLEYYGAATSAAALRSLPLPSLPAYNDTGAVANFSASFRSLASAQYPARVPRTVDRHFFFAVGLGADPCQSPVNGTCQGPNNTRFAASMNNVSFVMPRTSLLQAHYQRRYNGVLAANFPAAPRTPFNYTGT-----PPNNTFVTHGTRVVPLSFNTTVEVVLQDTSILG---AESHPLHLHGYDF 449          

HSP 2 Score: 27.7202 bits (60), Expect = 1.488e-12
Identity = 9/15 (60.00%), Postives = 10/15 (66.67%), Query Frame = 1
Query:  736 GWTALRIXADNPXAW 780
            GW A+R  ADNP  W
Sbjct:  485 GWVAIRFVADNPGVW 499          
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: LAC4_ORYSJ (Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 3.252e-12
Identity = 67/238 (28.15%), Postives = 106/238 (44.54%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTTN-QDPSYNYWISAG-VRGRKPATPPALT---LLNYH-----PTSASKIPLSP--PPITPRWDDYDHSKSFSNKIFALMGSPKP---PTNFHRRLTL------------LNTQNTINGFTKWAINNVSLTLPPTPYLGSIKYGLKD-AFDQNGPPENFSNEYDVMKPPVNANTTLGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            YV+PF VD + I  G++ +VLLT     P  N+++SA      +P T    T   +L Y      P++AS +   P   P  P+ +D D   +F++K+ +L     P   P +  +R               +  Q   N     ++NNVS  LP    L S   GL    +  + P    S       PP N N   G+ + +L  NT+V++++Q+   +     E+HP HLHG +F
Sbjct:  255 YVKPFTVDTLVISPGQTTNVLLTAKPYYPGANFYMSAAPYSTARPGTFGNTTVAGILEYENPAMSPSAASFVKGLPLFKPTLPQLNDTDFVTNFTDKLRSLATPEYPAAVPQSVDKRFFFTVGLGTLPCPANMTCQGPNNTQMAASMNNVSFVLPARALLQSHFTGLSSGVYAPDFPVAPLSPFNYTGTPPNNTNVKTGTKLLVLRYNTSVELVMQDTSILG---IESHPLHLHGFNF 489          

HSP 2 Score: 27.7202 bits (60), Expect = 3.252e-12
Identity = 9/15 (60.00%), Postives = 10/15 (66.67%), Query Frame = 1
Query:  736 GWTALRIXADNPXAW 780
            GW A+R  ADNP  W
Sbjct:  525 GWVAIRFLADNPGVW 539          
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: LAC2_ORYSJ (Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 9.248e-12
Identity = 56/226 (24.78%), Postives = 104/226 (46.02%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTTNQDPSYNYWISAGVRGRK-PA-TPPALTLLNYHPTSASKIPLSPPPITPRWDDYDHSKSFSNKIFALMGSPKPPTNF------HRRLTL---LNTQNTINGFTKWA--INNVSLTLPPTPYLGSIKYGLKDAFDQN---GPPENFSNEYDVMKPPVNANTTLGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            Y +PF    + +  G++ +VL++ +Q P   + ++        PA    A  +L Y     S +P  P  + P  +      +F +K+ +L  SP+ P +       H   T+   ++   T    ++ A  +NN++  +P T  L +  YG K  F  +    PP  F+  Y  +       T+LG+ +  +  N TV+++LQ+   +     E+HP+HLHG++F
Sbjct:  254 YTKPFAASTVQLSPGQTMNVLVSADQSPGRYFMVAKPFNDVPIPADNKTATAILQYAGVPTSVVPALPQTM-PATNSTGSVAAFHDKLRSL-NSPRYPADVPLAVDRHLLYTIGLNIDPCETCLNRSRLAASLNNITFVMPRTALLQAHYYGQKGVFAADFPDRPPARFN--YTGVPLTAGLGTSLGTRLSKIAYNATVELVLQDTNLLSV---ESHPFHLHGYNF 472          

HSP 2 Score: 29.6462 bits (65), Expect = 9.248e-12
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 1
Query:  736 GWTALRIXADNPXAW 780
            GWTA+R  ADNP  W
Sbjct:  508 GWTAIRFRADNPGVW 522          
BLAST of EY659301 vs. ExPASy Swiss-Prot
Match: LAC12_ARATH (Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.626e-11
Identity = 68/242 (28.10%), Postives = 103/242 (42.56%), Query Frame = 3
Query:    3 YVQPFEVDDMDIYSGESYSVLLTTNQDPSYNYWISAGVRGRKPATP----PALTLLNYHPTSASKIPLSPPPITPRWDDYDHSKSFSNKIFALMGSPKPPT--------------NFHRRLTLLNTQNTING--FTKWAINNVSLTLPPTPYLGSIKYGLKDAFDQNGPPENFSNEYDVMKPPVNANTT------------LGSGVYMLGLNTTVDVILQNAYAIMPNLSETHPWHLHGHDF 632
            Y++PF    + +  G++  VLLT +Q P   Y+I+A         P        +L Y  T+ +  P+ P  + P ++D +   SFS K  +L     P T              N  ++      Q  +NG  FT  ++NNVS  LP         + L  A   NG P  F+ ++   KPPV  + T             G+ +Y L   + V V+LQ+   +    SE HP HLHG+DF
Sbjct:  251 YLKPFTTKVLMLGPGQTTDVLLTADQPPK-RYYIAARAYQSAQNAPFDNTTTTAILQYKKTTTTSKPIMP--VLPAFNDTNTVTSFSRKFKSLRNVVVPKTIDDNLFFTIGLGLDNCPKKFPKSRCQG-LNGTRFTA-SMNNVSFVLPSN-------FSLLQAHS-NGIPGVFTTDFP-SKPPVKFDYTGNNISRALFQPVKGTKLYKLKYGSRVQVVLQDTNIVT---SENHPIHLHGYDF 475          

HSP 2 Score: 26.1794 bits (56), Expect = 2.626e-11
Identity = 8/15 (53.33%), Postives = 9/15 (60.00%), Query Frame = 1
Query:  736 GWTALRIXADNPXAW 780
            GW  +R  ADNP  W
Sbjct:  511 GWAVIRFVADNPGVW 525          
The following BLAST results are available for this feature:
BLAST of EY659301 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ASO_TOBAC3.542e-9469.52L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE... [more]
ASO_CUCPM2.493e-9266.19L-ascorbate oxidase OS=Cucurbita pepo var. melopep... [more]
ASO_CUCMA2.727e-9165.24L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=... [more]
ASO_CUCSA3.557e-9166.67L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1[more]
LAC16_ARATH2.637e-1629.69Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 S... [more]
LAC22_ORYSJ5.226e-1329.20Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC2... [more]
LAC11_ORYSJ1.488e-1229.17Putative laccase-11 OS=Oryza sativa subsp. japonic... [more]
LAC4_ORYSJ3.252e-1228.15Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 ... [more]
LAC2_ORYSJ9.248e-1224.78Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 ... [more]
LAC12_ARATH2.626e-1128.10Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-F04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659301 ID=EY659301|Name=EY659301|organism=Citrus sinensis|type=EST|length=924bp
ATTACGTGCAACCATTTGAAGTAGATGACATGGACATATATTCTGGTGAG
AGCTATTCGGTCTTATTAACAACAAATCAAGATCCCTCCTATAATTACTG
GATCTCAGCTGGTGTTAGGGGAAGAAAACCTGCAACCCCTCCGGCCCTAA
CACTCTTAAACTATCATCCCACTTCTGCTTCCAAAATCCCTCTCTCCCCA
CCACCTATAACCCCTAGATGGGACGACTATGATCACAGCAAATCATTCTC
CAACAAAATATTTGCCCTAATGGGATCCCCCAAGCCTCCCACAAATTTCC
ACCGTCGGCTCACCCTTCTTAACACTCAAAACACCATTAACGGGTTCACT
AAGTGGGCTATTAACAATGTGTCCCTGACTTTACCCCCCACTCCTTACTT
AGGATCCATCAAATATGGTCTTAAAGATGCTTTTGATCAGAATGGTCCCC
CCGAAAACTTCTCGAATGAGTATGACGTGATGAAACCTCCTGTAAACGCT
AATACAACTCTTGGAAGTGGGGTTTACATGCTTGGTTTAAACACCACAGT
TGATGTTATACTTCAAAATGCATACGCGATAATGCCAAACTTGAGTGAAA
CCCACCCTTGGCATTTGCATGGGCATGATTTTTNGGGTATTAGGGGCGCG
AGAAGGGAAAGTTACCAAAGAAGATGAGAAGAAATTTAACTTGAAGAATC
CANCATTGAAAAATACTGGCGTGATATTCCCATATGGCTGGACTGCTTTA
AGAATTGNTGCTGATAATCCANGTGCTTGGGGCATTCACTGNCATATTGA
GCCCCATTTNCATATGGAATGGGTGGTGGTTCTTGCTCTGGGGGTTGAAC
CGNNTGTAATATCCAAACCCAGCGTGGCCTGGGGTNGACTGGGAAAAGGT
CATGAACCTTAACAAAATGAGCTG
back to top