EY659203

Overview
NameEY659203
Unique NameEY659203
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length896
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659203 vs. ExPASy Swiss-Prot
Match: LEC2_CLALU (Agglutinin-2 OS=Cladrastis lutea PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.494e-11
Identity = 70/233 (30.04%), Postives = 102/233 (43.78%), Query Frame = 3
Query:  114 DNKTLICYG--AIESSG-ALSITPGPPPNLPIR-KVGRVLYGKPLSLQRSFID------TTITIKISRHQNYTDRAGDGMTFIFASDKNGPSAKGVGEYLGLQSSPGDKFPPL----AVELDTCLNKNLXXXXXXXXXXXXXXXESNPVNSLLDV--DLKSGRAIQVRIYYNPDFGQLSVYAAYSGETLVK--VVEKPINLSDIIPTPVYVGFTAATGDFLESHEVINWTFNS 758
            D + LI  G   I S G +L +T       P+R  VGR LY  PL L  S  +      TT T  +S   + T+  GDG+ F  A  +        G  LGL S        L    AVE DT +N N                + N + S   V    ++G     +I YN D  +LSV ++Y      +   V   ++L   +P  V VGF+ +TG ++++H +++WTFNS
Sbjct:   49 DQRDLILQGDAKISSGGDSLQLTKTDTSGKPVRGSVGRALYYTPLHLWDSSTNRLASFQTTFTFVLS---SPTNNPGDGIAFFIAPPETTIPPGSSGGLLGLFSPDNALNNSLNQIVAVEFDTFVNNN------WDPSHRHIGIDVNTIKSSATVRWQRENGSLATAQISYNSDTKKLSVVSSYPNTQANEDYTVSYDVDLKTELPEWVRVGFSGSTGGYVQNHNILSWTFNS 272          
The following BLAST results are available for this feature:
BLAST of EY659203 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
LEC2_CLALU1.494e-1130.04Agglutinin-2 OS=Cladrastis lutea PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-E08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659203 ID=EY659203|Name=EY659203|organism=Citrus sinensis|type=EST|length=896bp
AAAAAGATTTTCCTACTACTCCTCTCCGTTTTTCTTCGCGGAGCTTCTTC
ATCAATCCTTTCCGAAGACCACCTATTAGCTTCTCATTTCCCTCATTCGC
CAAAGACAGTTGTGACAATAAGACCCTCATTTGCTACGGAGCGATTGAAA
GTTCCGGCGCCTTAAGCATCACACCAGGCCCTCCACCAAACCTGCCGATC
AGAAAGGTTGGACGGGTTTTATACGGCAAGCCTCTGAGTTTACAGCGATC
TTTTATTGATACCACCATCACCATTAAGATCTCACGCCATCAGAATTACA
CTGATCGTGCCGGAGATGGCATGACGTTCATTTTTGCAAGCGATAAAAAC
GGTCCATCAGCAAAGGGCGTCGGCGAATATCTTGGACTGCAGTCTTCACC
AGGCGATAAATTTCCTCCATTAGCCGTGGAGCTGGACACATGCCTGAACA
AGAACCTGAATGATCCAGATGATAACCATATTGGCATCGACATAAACGGA
ATCGAATCAAATCCAGTTAATAGTCTGCTTGACGTTGATCTCAAAAGTGG
ACGAGCAATCCAGGTTCGAATTTATTACAATCCAGACTTTGGACAACTCT
CTGTTTATGCGGCATATTCGGGGGAAACACTTGTGAAGGTGGTTGAAAAA
CCCATTAACCTGTCAGATATAATTCCAACGCCCGTCTATGTTGGATTCAC
AGCAGCTACGGGGGACTTTTTAGAAAGCCATGAGGTTATAAATTGGACCT
TCAACTCGTTCCCAGTGCCGCCTTCTCTCAGGAGGAAAACCTGGTGATGC
CNATATATNCTAANCCGTNCTTGAAAAACATGTCACATAAATATTTATCA
ATATAATTATATCACCAATAAGTGACATGGCTCTTGCATTAAAAAT
back to top