EY659202

Overview
NameEY659202
Unique NameEY659202
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length942
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659202_ssr388 microsatellite EY659202_ssr388:388..399. BLAST: Citrus ESTs to TAIR9
Csv1_Contig6352 contig Csv1_Contig6352:593..1540. BLAST: Citrus Unigene V1 Contigs to TAIR9
Homology
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_CITSI (Photosystem I assembly protein ycf3 OS=Citrus sinensis GN=ycf3 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.267e-16
Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 42          
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_VITVI (Photosystem I assembly protein ycf3 OS=Vitis vinifera GN=ycf3 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.286e-16
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTT GEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42          
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_RANMC (Photosystem I assembly protein ycf3 OS=Ranunculus macranthus GN=ycf3 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.286e-16
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTT GEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42          
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_PANGI (Photosystem I assembly protein ycf3 OS=Panax ginseng GN=ycf3 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.286e-16
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTT GEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42          
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_OENEH (Photosystem I assembly protein ycf3 OS=Oenothera elata subsp. hookeri GN=ycf3 PE=3 SV=3)

HSP 1 Score: 85.1149 bits (209), Expect = 6.286e-16
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTT GEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42          
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_NANDO (Photosystem I assembly protein ycf3 OS=Nandina domestica GN=ycf3 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.286e-16
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTT GEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42          
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_LEMMI (Photosystem I assembly protein ycf3 OS=Lemna minor GN=ycf3 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.286e-16
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTT GEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42          
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_LACSA (Photosystem I assembly protein ycf3 OS=Lactuca sativa GN=ycf3 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.286e-16
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTT GEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42          
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_JASNU (Photosystem I assembly protein ycf3 OS=Jasminum nudiflorum GN=ycf3 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.286e-16
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTT GEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42          
BLAST of EY659202 vs. ExPASy Swiss-Prot
Match: YCF3_IPOPU (Photosystem I assembly protein ycf3 OS=Ipomoea purpurea GN=ycf3 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.286e-16
Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  222 MPRSRINGNFIDKTFSIVANILLRIIPTTVGEKEAFTYYRDG 347
            MPRSRINGNFIDKTFSIVANILLRIIPTT GEKEAFTYYRDG
Sbjct:    1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42          
The following BLAST results are available for this feature:
BLAST of EY659202 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 79
Match NameE-valueIdentityDescription
YCF3_CITSI1.267e-16100.00Photosystem I assembly protein ycf3 OS=Citrus sine... [more]
YCF3_VITVI6.286e-1697.62Photosystem I assembly protein ycf3 OS=Vitis vinif... [more]
YCF3_RANMC6.286e-1697.62Photosystem I assembly protein ycf3 OS=Ranunculus ... [more]
YCF3_PANGI6.286e-1697.62Photosystem I assembly protein ycf3 OS=Panax ginse... [more]
YCF3_OENEH6.286e-1697.62Photosystem I assembly protein ycf3 OS=Oenothera e... [more]
YCF3_NANDO6.286e-1697.62Photosystem I assembly protein ycf3 OS=Nandina dom... [more]
YCF3_LEMMI6.286e-1697.62Photosystem I assembly protein ycf3 OS=Lemna minor... [more]
YCF3_LACSA6.286e-1697.62Photosystem I assembly protein ycf3 OS=Lactuca sat... [more]
YCF3_JASNU6.286e-1697.62Photosystem I assembly protein ycf3 OS=Jasminum nu... [more]
YCF3_IPOPU6.286e-1697.62Photosystem I assembly protein ycf3 OS=Ipomoea pur... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-E07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659202 ID=EY659202|Name=EY659202|organism=Citrus sinensis|type=EST|length=942bp
CCGGNATTAAAGCCTCGACCCACGCGTCCGTTTTTTTTTTTCTGATATTT
CTACCTGATTTAATCAATGAGTTGGAACGAATCAACGGATCGGTCTATTT
TTTTTTTTATTTTTTTTAACACGTCTGCTTTTATGTTATTTTGTACTGTA
CAATTCCTTTGTTTGTGGGATCATTTTCTCACAAGAGGTAATGAAACGAA
TTATAGAATGGATTTTTACCTATGCCTAGATCGCGGATAAACGGAAATTT
TATTGATAAGACCTTTTCGATTGTAGCCAATATATTATTACGAATAATTC
CGACAACTGTAGGAGAAAAAGAGGCATTTACCTATTACAGAGATGGTGCG
ATTTGATTAGTTTTTTATTTACCCCTTTCGGTCTTAGAAGAAAGAAAGAC
AATTCGGGATAGAAAAAAAAAAAAAAAAGATTATTGAAAAAATCTACGCT
TGTTGAAGGTGAAGTTTATAGATAAAACCATTCCTTCTGTCGTGTATCCC
CGATTAATGCAGCCTCAGATGCTTCAATTGTCGATTCTAGTATTGAGCGA
AAGGTTACACCTATGGGTTCTGTATTGCAAGTCAACCCTACTACACCAGT
ACCAATAGGCGGCATAGGGGAAGAGGCGCTACGTCTAGGAATCAGCAACA
CGAAAACTTTGTTATAAACTGCCCCCTTCCTTAGCGGGATCGGGACTAAG
AAGAATGGTTGGGATAACAAACATCCATCTCGTTCGTACTGTGGATACCC
GTATAACCATCGAAGACTGTTGAAGTGATAATTNCCTGTAAATTAAAGGG
GCGTGAGAACAAGAAATTGTTGAGTTTNCGGTTTTATCTAGTACCAACAC
GCGTGATATAAAGAAAAAGCTTTGCAAAAGGTTNGCTAGAGATTNCNNTG
TAAACATTACCCCCCTTAGTTCATATGAGAATATTCAATCTT
back to top