EY659198

Overview
NameEY659198
Unique NameEY659198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length936
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANXD4_ARATH (Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 3.749e-37
Identity = 85/159 (53.46%), Postives = 114/159 (71.70%), Query Frame = 2
Query:   53 ERHARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKS*AK----ALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAGQPFEDELDVHLILQAAGQGLISP 517
            ER ARL+K+ALKKG  + ++IVE++ TRS+++LLGARKAYHSLF+ S+EED+ASH+HG ++KLLV LVSAYRYEG K+K+D AKS AK    A+ S+GE A     +E DEVVRIL+T SK HL+ ++K + EI G      +    +L  A   L+ P
Sbjct:   89 ERDARLVKKALKKGEEAYNLIVEVSCTRSAEDLLGARKAYHSLFDQSMEEDIASHVHGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAEAVASSGEEA-----VEKDEVVRILTTRSKLHLQHLYKHFNEIKGSDLLGGVSKSSLLNEALICLLKP 242          
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANXD1_ARATH (Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.608e-22
Identity = 58/140 (41.43%), Postives = 88/140 (62.86%), Query Frame = 2
Query:   53 ERHARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKS*AKALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAGQPFEDELD 472
            ER A L  EA K+  +SN V++E+A TR+S +LL AR+AYH+ ++ S+EEDVA H  G  +KLLV+LV++YRYEG ++   +AK  AK +        K     +++V+RILST SK  + + F  Y++  G+     L+
Sbjct:   86 ERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLV----HEKIKDKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLE 221          
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANX4_FRAAN (Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 8.390e-21
Identity = 56/132 (42.42%), Postives = 82/132 (62.12%), Query Frame = 2
Query:   53 ERHARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKS*AKALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAG 448
            +R A L   A+KK  +  +VI+EI+   S +ELL  R+AY   ++HS+EED+A+H  G  +KLLVALV+AYRY+G +I   +A S A  L     +A K     ++E++RILST SK  L + F  Y++  G
Sbjct:   85 DRDAVLANVAIKKSTDVYNVIIEISCIHSPEELLAVRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADIL----HDAIKDKAFNHEEIIRILSTRSKTQLMATFNKYRDDQG 212          
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANXD7_ARATH (Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.013e-19
Identity = 55/132 (41.67%), Postives = 80/132 (60.61%), Query Frame = 2
Query:   53 ERHARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKS*AKALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAG 448
            ER A L KE+ K    +N V+VEIA TRS+ EL  A++AY + ++ S+EEDVA H  G  +KLLV LVS +RY+G ++   +A+S AK L        K+    +D+++RIL+T SK  + +    YK   G
Sbjct:   86 ERDAYLAKESTKMFTKNNWVLVEIACTRSALELFNAKQAYQARYKTSLEEDVAYHTSGDIRKLLVPLVSTFRYDGDEVNMTLARSEAKIL----HEKIKEKAYADDDLIRILTTRSKAQISATLNHYKNNFG 213          
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANXD2_ARATH (Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.309e-17
Identity = 54/139 (38.85%), Postives = 76/139 (54.68%), Query Frame = 2
Query:   53 ERHARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKS*AKALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAGQPFEDEL 469
            ER A L KE+ K    +N V+VEIA TR + EL+  ++AY + ++ SIEEDVA H  G  +KLL+ LVS +RYEG  +   +A+S AK L         +    +D+ +RIL+T SK  L +    Y    G      L
Sbjct:   86 ERDAYLAKESTKMFTKNNWVLVEIACTRPALELIKVKQAYQARYKKSIEEDVAQHTSGDLRKLLLPLVSTFRYEGDDVNMMLARSEAKIL----HEKVSEKSYSDDDFIRILTTRSKAQLGATLNHYNNEYGNAINKNL 220          
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANX13_HUMAN (Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3)

HSP 1 Score: 80.4925 bits (197), Expect = 1.533e-14
Identity = 46/140 (32.86%), Postives = 80/140 (57.14%), Query Frame = 2
Query:   53 ERHARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKS*AKALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAGQPFEDELD 472
            E  AR +++A+K      SV++E+  TR++ E++  ++AY  LF+ S+E DV     G  KK+LV+L+ A R EG  + +D+A   AK L  AGE     + +  +EV   L+  S   L++ F+ Y+ + G+  E+ ++
Sbjct:   89 EYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYDAGEGRWGTDELAFNEV---LAKRSYKQLRATFQAYQILIGKDIEEAIE 225          
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANXD3_ARATH (Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 2.614e-14
Identity = 55/145 (37.93%), Postives = 78/145 (53.79%), Query Frame = 2
Query:   53 ERHARLI-----KEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKS*AKALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAGQPFEDELD 472
            ER ARL+     KE  KK   +  VIVEI+ T S + L+  RKAY SLF+ S+EE +AS +     KLLV L S +RY+  +   +VA   A  L  A E  +    +++D V+ IL T S   L+  F  YK+  G   + ++D
Sbjct:   86 ERDARLVNKILNKEKKKKSLENLKVIVEISCTTSPNHLIAVRKAYCSLFDSSLEEHIASSLPFPLAKLLVTLASTFRYDKDRTDAEVATIEAAMLREAIEKKQ----LDHDHVLYILGTRSIYQLRETFVAYKKNYGVTIDKDVD 226          
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANXD6_ARATH (Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.934e-14
Identity = 49/134 (36.57%), Postives = 75/134 (55.97%), Query Frame = 2
Query:   53 ERHARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEG--PKIKEDVAKS*AKALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAG 448
            ER A L  E+ K    +  V+VEIA TR S E    ++AYH  ++ S+EEDVA H  G  +KLLV LVS +RY+G   ++   +A+S AK L         +    +++++RIL+T SK  + +    +K+  G
Sbjct:   86 ERDAYLANESTKLFTKNIWVLVEIACTRPSLEFFKTKQAYHVRYKTSLEEDVAYHTSGNIRKLLVPLVSTFRYDGNADEVNVKLARSEAKTL----HKKITEKAYTDEDLIRILTTRSKAQINATLNHFKDKFG 215          
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANX13_CANFA (Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 1.098e-12
Identity = 43/140 (30.71%), Postives = 79/140 (56.43%), Query Frame = 2
Query:   53 ERHARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKS*AKALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAGQPFEDELD 472
            E  AR +++A+K      +V++EI  TR++ E++  ++AY  LF+ S+E DV +   G  K +LV+L+ A R EG  + +D+A   AK L  AG+     + +  +EV   L+  S   L++ F+ Y+ +  +  E+ ++
Sbjct:   89 EYDARQLQKAMKGLGTDEAVLIEILCTRTNKEIMAIKEAYQRLFDRSLESDVKADTSGNLKAILVSLLQANRDEGDDVDKDLAGQDAKDLYDAGDGRWGTDELAFNEV---LAKRSHKQLRATFQAYQILIDKDIEEAIE 225          
BLAST of EY659198 vs. ExPASy Swiss-Prot
Match: ANXA3_MOUSE (Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3)

HSP 1 Score: 72.7886 bits (177), Expect = 3.196e-12
Identity = 41/136 (30.15%), Postives = 74/136 (54.41%), Query Frame = 2
Query:   62 ARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKS*AKALISAGENAEKQNPIENDEVVRILSTMSKPHLKSVFKPYKEIAGQPFEDEL 469
            A  +K+++K        ++EI +TRSS ++    +AY+++++ S+ +D++S   G  +K L+ L    R E  K+ E +AK  A+ L +AGEN   +   + D+   +L   S P LK  F  Y+ I+ +  ED +
Sbjct:   96 ANELKKSMKGTGTDEDALIEILTTRSSRQMKEISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKKDAQILYNAGEN---KWGTDEDKFTEVLCLRSFPQLKLTFDEYRNISQKDIEDSI 228          
The following BLAST results are available for this feature:
BLAST of EY659198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
ANXD4_ARATH3.749e-3753.46Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV... [more]
ANXD1_ARATH2.608e-2241.43Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV... [more]
ANX4_FRAAN8.390e-2142.42Annexin-like protein RJ4 OS=Fragaria ananassa PE=2... [more]
ANXD7_ARATH6.013e-1941.67Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 ... [more]
ANXD2_ARATH4.309e-1738.85Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV... [more]
ANX13_HUMAN1.533e-1432.86Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3[more]
ANXD3_ARATH2.614e-1437.93Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV... [more]
ANXD6_ARATH9.934e-1436.57Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV... [more]
ANX13_CANFA1.098e-1230.71Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=... [more]
ANXA3_MOUSE3.196e-1230.15Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-E03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659198 ID=EY659198|Name=EY659198|organism=Citrus sinensis|type=EST|length=936bp
TACAGAACCGACCCACTCGTCCGCGGACGCGTGTGCGGACGCGTGGGCTT
GGGAAAGGCATGCTCGGTTGATAAAGGAGGCACTGAAAAAGGGACCAAAT
TCGAACAGTGTGATTGTGGAGATTGCGAGTACCAGATCGTCAGATGAGTT
GCTCGGAGCAAGGAAGGCTTACCATTCTCTCTTTGAGCATTCAATCGAAG
AAGATGTTGCGTCCCACATCCATGGGAAGGAGAAAAAGCTCTTGGTAGCA
CTTGTGAGTGCATATAGGTACGAAGGACCGAAGATCAAAGAAGATGTTGC
GAAATCATAAGCCAAGGCACTTATCAGTGCAGGTGAGAATGCGGAAAAGC
AGAATCCTATTGAGAATGATGAGGTCGTAAGGATCTTATCTACAATGAGC
AAGCCTCATCTCAAGTCGGTATTTAAGCCCTACAAGGAAATTGCCGGCCA
GCCCTTTGAAGATGAACTTGATGTCCACTTGATACTGCAAGCAGCAGGGC
AGGGCTTAATTTCTCCTCATCATATTTCAGCCGGGTCTTGGATGAAGGAA
TGAGAGATGGTGCCGGTTAGATTCTAAAAAGGGATTGACCCGAGTTCCTT
GGGAACCCAGCTGTTGTGGACCTACAGCCGATCAGGACGACTCCCGGAAC
ACTTTGCGTTCCCTTGGCTGTTAATTTGAAGCTAGGCCAAGGGGGCTTTT
GGAATTCCGGTTACTTTATGCGAGAGGAAATTGATCAGTGCCAACCCCGC
CCCCTTTTTCAAATTAGAATTCTTCACCCTGTTAAAAATTTCCGCATTGG
ATTAATTGGTCTGTGTTTGCTCTATTGTTTCACCGGATGGGTGTGTGCTT
AAATTGGCCGAAAGATGGTCCTTTATTAAGATTGGCTGGCTTGGTGGACC
GCTAAAATGGGTGTTCAAAAAAAAAAATAAATTGTG
back to top