EY743383
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY743383 vs. ExPASy Swiss-Prot
Match: PIP27_ARATH (Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 8.647e-12 Identity = 32/45 (71.11%), Postives = 35/45 (77.78%), Query Frame = 2 Query: 92 SEKACDDQCIFWVGPFIVAFVAAFYHQYILMAAAINALGSFLINA 226 +EKA DDQ IFWVGPF+ A AA YHQYIL A+AI ALGSF NA Sbjct: 234 NEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNA 278 HSP 2 Score: 26.1794 bits (56), Expect = 8.647e-12 Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 1 Query: 61 RSFGAAVIYNKRKS 102 RSFGAAVIYN K+ Sbjct: 224 RSFGAAVIYNNEKA 237
BLAST of EY743383 vs. ExPASy Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 3.186e-11 Identity = 31/41 (75.61%), Postives = 33/41 (80.49%), Query Frame = 2 Query: 92 SEKACDDQCIFWVGPFIVAFVAAFYHQYILMAAAINALGSF 214 +EKA DDQ IFWVGP I A AAFYHQ+IL AAAI ALGSF Sbjct: 241 NEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSF 281 HSP 2 Score: 26.1794 bits (56), Expect = 3.186e-11 Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 1 Query: 61 RSFGAAVIYNKRKS 102 RSFGAAVIYN K+ Sbjct: 231 RSFGAAVIYNNEKA 244 The following BLAST results are available for this feature:
BLAST of EY743383 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY743383 ID=EY743383; Name=EY743383; organism=Citrus sinensis; type=EST; length=933bpback to top |