EY702711

Overview
NameEY702711
Unique NameEY702711
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length869
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9998 contig Csv1_Contig9998:1..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_SYNY3 (ATP-dependent DNA helicase recG OS=Synechocystis sp. (strain PCC 6803) GN=recG PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.193e-40
Identity = 52/116 (44.83%), Postives = 84/116 (72.41%), Query Frame = 2
Query:  443 APHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQR-FQDYSCGLXPGEMKSDEK 787
            APHVL+M+ATPIPRTLAL L+GD+ ++QI +LPPGR PI T +I   E+    +Y+++  E+  G +VY+++P IE+SE+L  ++AA  + + ++++ F +++ GL  G +KS EK
Sbjct:  553 APHVLSMTATPIPRTLALTLHGDLEVSQIDELPPGRQPIHTSVITAKER--PQMYELIRREVAQGRQVYIIFPAIEESEKL-DIKAAVEEHKYLTEKIFPNFNIGLLHGRLKSAEK 665          

HSP 2 Score: 84.3445 bits (207), Expect = 2.193e-40
Identity = 46/100 (46.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSK 392
            QAA M PTE+LA QHY+ L+   + +    + P + LLTGST   + R I   L TG + L++GTH+LI E V F  L L ++DEQ RFGV QR +  +K
Sbjct:  456 QAALMAPTEVLAEQHYQKLVSWFNLL----YLP-VELLTGSTKTAKRREIHAQLSTGQLPLLVGTHALIQETVNFQRLGLVVIDEQHRFGVQQRAKLLAK 550          
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_AQUAE (ATP-dependent DNA helicase recG OS=Aquifex aeolicus GN=recG PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.373e-39
Identity = 54/115 (46.96%), Postives = 77/115 (66.96%), Query Frame = 2
Query:  446 PHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQRFQDYSCGLXPGEMKSDEKM 790
            PH L MSATPIPRTLAL++YGD+ ++ I +LPPGR  + T +   ++K  E VYK + +EL+ G KVY++YP+IE+SE+L  L+AA  + E   + F D    L  G+M   EK+
Sbjct:  511 PHCLVMSATPIPRTLALSIYGDLDISIIDELPPGRKEVITKLYFESQK--EEVYKKVEEELKKGNKVYVIYPLIEESEKL-NLKAATEEYERWKKLFPDRKVLLLHGKMPDKEKL 622          

HSP 2 Score: 83.1889 bits (204), Expect = 2.373e-39
Identity = 43/94 (45.74%), Postives = 62/94 (65.96%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQR 374
            Q A MVPTE+LA QHY+   ++L +     +   +ALLTGS    Q + + K ++ G+I +++GTH+LI +KVEF  L   I+DEQ RFGV+QR
Sbjct:  411 QVAVMVPTEILAHQHYKKFSEMLKD-----YGVNVALLTGSLTPSQKKSVYKHVKEGNIHVLVGTHALIQDKVEFKNLGYVIIDEQHRFGVMQR 499          
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_STRPN (ATP-dependent DNA helicase recG OS=Streptococcus pneumoniae GN=recG PE=3 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 1.705e-33
Identity = 46/94 (48.94%), Postives = 61/94 (64.89%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQR 374
            QAA MVPTE+LA QH+E L  L  N+       K+ALLTGS    + R + + +  G+  L+IGTH+LI + VE++ L L I+DEQ RFGV QR
Sbjct:  303 QAALMVPTEILAEQHFESLQNLFPNL-------KLALLTGSLKAAEKREVLETIAKGEADLIIGTHALIQDGVEYARLGLIIIDEQHRFGVGQR 389          

HSP 2 Score: 78.1814 bits (191), Expect = 1.705e-33
Identity = 47/114 (41.23%), Postives = 63/114 (55.26%), Query Frame = 2
Query:  446 PHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQRFQDYSCGLXPGEMKSDEK 787
            P VL M+ATPIPRTLA+  +GDM ++ I  +P GR PI T  I+  +     V   +  E+Q G +VY++ P+IE+SE L    A A   E  +         L  G MKSDEK
Sbjct:  399 PDVLMMTATPIPRTLAITAFGDMDVSIIDQMPAGRKPIVTRWIKHEQ--LPQVLTWLEGEIQKGSQVYVISPLIEESEALDLKNAIALSEELTTHFAGKAEVALLHGRMKSDEK 510          
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_STAES (ATP-dependent DNA helicase recG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=recG PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.892e-33
Identity = 42/113 (37.17%), Postives = 71/113 (62.83%), Query Frame = 2
Query:  449 HVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQRFQDYSCGLXPGEMKSDEK 787
            +VL M+ATPIPRTLA++++G+M ++ I  LP GR PIKT   +  +  Y+ V   M +EL+ G + Y++ P+IE SE L  ++   +  E++   + +   GL  G+M +++K
Sbjct:  409 NVLFMTATPIPRTLAISVFGEMDVSSIKQLPKGRKPIKTSWAKHEQ--YDQVLAQMSNELKKGRQAYVICPLIESSEHLEDVQNVVALYESLQSDYGNEKVGLLHGKMSAEDK 519          

HSP 2 Score: 81.2629 bits (199), Expect = 2.892e-33
Identity = 45/94 (47.87%), Postives = 60/94 (63.83%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQR 374
            Q+A MVPTE+LA QH E L++L  N         +ALLTGS   K+ R++ + L+ G I  +IGTH+LI + V F+ + L I DEQ RFGV QR
Sbjct:  311 QSALMVPTEILAEQHAESLIQLFGNTMN------VALLTGSVKGKKRRLLLEQLENGTIDCLIGTHALIQDDVVFNNVGLVITDEQHRFGVNQR 398          
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_STAEQ (ATP-dependent DNA helicase recG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=recG PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.906e-33
Identity = 42/113 (37.17%), Postives = 70/113 (61.95%), Query Frame = 2
Query:  449 HVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQRFQDYSCGLXPGEMKSDEK 787
            +VL M+ATPIPRTLA++++G+M ++ I  LP GR PIKT   +  +  Y+ V   M +EL+ G + Y++ P+IE SE L  ++      E++   + +   GL  G+M +++K
Sbjct:  409 NVLFMTATPIPRTLAISVFGEMDVSSIKQLPKGRKPIKTSWAKHEQ--YDQVLAQMSNELKKGRQAYVICPLIESSEHLEDVQNVVELYESLQSDYGNEKVGLLHGKMTAEDK 519          

HSP 2 Score: 81.2629 bits (199), Expect = 4.906e-33
Identity = 45/94 (47.87%), Postives = 60/94 (63.83%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQR 374
            Q+A MVPTE+LA QH E L++L  N         +ALLTGS   K+ R++ + L+ G I  +IGTH+LI + V F+ + L I DEQ RFGV QR
Sbjct:  311 QSALMVPTEILAEQHAESLMQLFGNTMN------VALLTGSVKGKKRRLLLEQLENGTIDCLIGTHALIQDDVVFNNVGLVITDEQHRFGVNQR 398          
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_STAAW (ATP-dependent DNA helicase recG OS=Staphylococcus aureus (strain MW2) GN=recG PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.520e-31
Identity = 43/113 (38.05%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  449 HVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQRFQDYSCGLXPGEMKSDEK 787
            +VL M+ATPIPRTLA++++G+M ++ I  LP GR PI T       + Y+ V   M  EL+ G + Y++ P+IE SE L  ++   +  E++ Q +     GL  G++ +DEK
Sbjct:  413 NVLFMTATPIPRTLAISVFGEMDVSSIKQLPKGRKPIIT--TWAKHEQYDKVLMQMTSELKKGRQAYVICPLIESSEHLEDVQNVVALYESLQQYYGVSRVGLLHGKLSADEK 523          

HSP 2 Score: 77.0258 bits (188), Expect = 1.520e-31
Identity = 46/101 (45.54%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLL-DNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSK 392
            Q+A MVPTE+LA QH E L+ L  D+M        +ALLTGS   K+ +++ + L+ G I  +IGTH+LI + V F  + L I DEQ RFGV QR     K
Sbjct:  315 QSALMVPTEILAEQHAESLMALFGDSMN-------VALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDVIFHNVGLVITDEQHRFGVNQRQLLREK 408          
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_STAAS (ATP-dependent DNA helicase recG OS=Staphylococcus aureus (strain MSSA476) GN=recG PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.520e-31
Identity = 43/113 (38.05%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  449 HVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQRFQDYSCGLXPGEMKSDEK 787
            +VL M+ATPIPRTLA++++G+M ++ I  LP GR PI T       + Y+ V   M  EL+ G + Y++ P+IE SE L  ++   +  E++ Q +     GL  G++ +DEK
Sbjct:  413 NVLFMTATPIPRTLAISVFGEMDVSSIKQLPKGRKPIIT--TWAKHEQYDKVLMQMTSELKKGRQAYVICPLIESSEHLEDVQNVVALYESLQQYYGVSRVGLLHGKLSADEK 523          

HSP 2 Score: 77.0258 bits (188), Expect = 1.520e-31
Identity = 46/101 (45.54%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLL-DNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSK 392
            Q+A MVPTE+LA QH E L+ L  D+M        +ALLTGS   K+ +++ + L+ G I  +IGTH+LI + V F  + L I DEQ RFGV QR     K
Sbjct:  315 QSALMVPTEILAEQHAESLMALFGDSMN-------VALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDVIFHNVGLVITDEQHRFGVNQRQLLREK 408          
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_STAAN (ATP-dependent DNA helicase recG OS=Staphylococcus aureus (strain N315) GN=recG PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.520e-31
Identity = 43/113 (38.05%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  449 HVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQRFQDYSCGLXPGEMKSDEK 787
            +VL M+ATPIPRTLA++++G+M ++ I  LP GR PI T       + Y+ V   M  EL+ G + Y++ P+IE SE L  ++   +  E++ Q +     GL  G++ +DEK
Sbjct:  413 NVLFMTATPIPRTLAISVFGEMDVSSIKQLPKGRKPIIT--TWAKHEQYDKVLMQMTSELKKGRQAYVICPLIESSEHLEDVQNVVALYESLQQYYGVSRVGLLHGKLSADEK 523          

HSP 2 Score: 77.0258 bits (188), Expect = 1.520e-31
Identity = 46/101 (45.54%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLL-DNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSK 392
            Q+A MVPTE+LA QH E L+ L  D+M        +ALLTGS   K+ +++ + L+ G I  +IGTH+LI + V F  + L I DEQ RFGV QR     K
Sbjct:  315 QSALMVPTEILAEQHAESLMALFGDSMN-------VALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDVIFHNVGLVITDEQHRFGVNQRQLLREK 408          
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_STAAM (ATP-dependent DNA helicase recG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=recG PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.520e-31
Identity = 43/113 (38.05%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  449 HVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQRFQDYSCGLXPGEMKSDEK 787
            +VL M+ATPIPRTLA++++G+M ++ I  LP GR PI T       + Y+ V   M  EL+ G + Y++ P+IE SE L  ++   +  E++ Q +     GL  G++ +DEK
Sbjct:  413 NVLFMTATPIPRTLAISVFGEMDVSSIKQLPKGRKPIIT--TWAKHEQYDKVLMQMTSELKKGRQAYVICPLIESSEHLEDVQNVVALYESLQQYYGVSRVGLLHGKLSADEK 523          

HSP 2 Score: 77.0258 bits (188), Expect = 1.520e-31
Identity = 46/101 (45.54%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLL-DNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSK 392
            Q+A MVPTE+LA QH E L+ L  D+M        +ALLTGS   K+ +++ + L+ G I  +IGTH+LI + V F  + L I DEQ RFGV QR     K
Sbjct:  315 QSALMVPTEILAEQHAESLMALFGDSMN-------VALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDVIFHNVGLVITDEQHRFGVNQRQLLREK 408          
BLAST of EY702711 vs. ExPASy Swiss-Prot
Match: RECG_STAAC (ATP-dependent DNA helicase recG OS=Staphylococcus aureus (strain COL) GN=recG PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.520e-31
Identity = 43/113 (38.05%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  449 HVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYKMMLDELQSGGKVYLVYPVIEQSEQLPQLRAAASDLETISQRFQDYSCGLXPGEMKSDEK 787
            +VL M+ATPIPRTLA++++G+M ++ I  LP GR PI T       + Y+ V   M  EL+ G + Y++ P+IE SE L  ++   +  E++ Q +     GL  G++ +DEK
Sbjct:  413 NVLFMTATPIPRTLAISVFGEMDVSSIKQLPKGRKPIIT--TWAKHEQYDKVLMQMTSELKKGRQAYVICPLIESSEHLEDVQNVVALYESLQQYYGVSRVGLLHGKLSADEK 523          

HSP 2 Score: 77.0258 bits (188), Expect = 1.520e-31
Identity = 46/101 (45.54%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   93 QAAFMVPTELLATQHYEHLLKLL-DNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSK 392
            Q+A MVPTE+LA QH E L+ L  D+M        +ALLTGS   K+ +++ + L+ G I  +IGTH+LI + V F  + L I DEQ RFGV QR     K
Sbjct:  315 QSALMVPTEILAEQHAESLMALFGDSMN-------VALLTGSVKGKKRKILLEQLENGTIDCLIGTHALIQDDVIFHNVGLVITDEQHRFGVNQRQLLREK 408          
The following BLAST results are available for this feature:
BLAST of EY702711 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
RECG_SYNY32.193e-4044.83ATP-dependent DNA helicase recG OS=Synechocystis s... [more]
RECG_AQUAE2.373e-3946.96ATP-dependent DNA helicase recG OS=Aquifex aeolicu... [more]
RECG_STRPN1.705e-3348.94ATP-dependent DNA helicase recG OS=Streptococcus p... [more]
RECG_STAES2.892e-3337.17ATP-dependent DNA helicase recG OS=Staphylococcus ... [more]
RECG_STAEQ4.906e-3337.17ATP-dependent DNA helicase recG OS=Staphylococcus ... [more]
RECG_STAAW1.520e-3138.05ATP-dependent DNA helicase recG OS=Staphylococcus ... [more]
RECG_STAAS1.520e-3138.05ATP-dependent DNA helicase recG OS=Staphylococcus ... [more]
RECG_STAAN1.520e-3138.05ATP-dependent DNA helicase recG OS=Staphylococcus ... [more]
RECG_STAAM1.520e-3138.05ATP-dependent DNA helicase recG OS=Staphylococcus ... [more]
RECG_STAAC1.520e-3138.05ATP-dependent DNA helicase recG OS=Staphylococcus ... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-011-D06-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702711 ID=EY702711|Name=EY702711|organism=Citrus sinensis|type=EST|length=869bp
CCACGCGTCCGGTAAAAGTTACTTTGTTCGAGGTCTTCTCATTTGGATAG
TTTAGTTCATAATGATGGTCGTCAGATTCAGTGTCTTTTCTTCAGGCAGC
TTTTATGGTTCCAACTGAGTTGCTTGCAACCCAGCACTATGAGCACTTGC
TTAAATTGCTAGATAATATGGAGGAGGACAAGCACAAACCTAAAATTGCC
TTACTAACAGGTTCAACACCAGTAAAACAATCCCGGATGATCCGTAAGGA
TCTTCAAACTGGAGATATCACTCTGGTCATTGGAACCCATAGTTTAATTG
CTGAAAAAGTTGAATTTTCTGCTTTACGCCTCGCTATTGTGGATGAACAA
CAACGCTTTGGTGTGGTACAGAGAGGCAGATTTAACAGTAAGGTATGGCA
ATGGTTAATTCAGACGGGTCTCCAAAAGATGATCAACATATGGCTCCTCA
TGTTCTTGCCATGTCAGCCACTCCTATCCCAAGAACGCTTGCTTTGGCAT
TATATGGGGATATGTCCTTAACACAGATAACTGACTTACCTCCAGGAAGG
ATACCTATTAAGACCTACATCATTGAAGGAAATGAGAAGGGCTATGAGAA
TGTGTACAAGATGATGCTTGACGAACTGCAATCAGGTGGAAAAGTGTACC
TTGTGTATCCTGTCATTGAACAATCTGAGCAGTTGCCCCAGCTCCGTGCT
GCTGCTTCAGATCTTGAAACTATATCTCAAAGATTTCAGGATTACAGCTG
CGGGTTGNTGCCTGGGGAAATGAAGAGTGACGAAAAGATGAGGTTTTAGA
ACGGTCAGATCTGGCGAGACACTATATTGCTTTCCACTAAGTAATTGAAA
TGGTGGTGATGGTCCCAAG
back to top