CX077922
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX077922 vs. ExPASy Swiss-Prot
Match: NU2M_BETVU (NADH-ubiquinone oxidoreductase chain 2 OS=Beta vulgaris GN=ND2 PE=3 SV=2) HSP 1 Score: 83.1889 bits (204), Expect = 2.925e-19 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 1 Query: 52 YMWAPDIYEGSPPPVTAFLSIAPKIPISANISRVFIYGSYGATLPQI 192 YMWAPDIYEGSP PVTAF SIAP+ ISANI RVFIYGSYGATL QI Sbjct: 217 YMWAPDIYEGSPTPVTAFFSIAPERSISANILRVFIYGSYGATLQQI 263 HSP 2 Score: 31.187 bits (69), Expect = 2.925e-19 Identity = 13/16 (81.25%), Postives = 14/16 (87.50%), Query Frame = 3 Query: 3 PKKTPLPFGLHISFDS 50 P KTPLPFGL+I FDS Sbjct: 201 PAKTPLPFGLNIFFDS 216
BLAST of CX077922 vs. ExPASy Swiss-Prot
Match: NU2M_OENBE (NADH-ubiquinone oxidoreductase chain 2 OS=Oenothera bertiana GN=ND2 PE=2 SV=2) HSP 1 Score: 86.2705 bits (212), Expect = 5.421e-17 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 1 Query: 34 ISLLTLYMWAPDIYEGSPPPVTAFLSIAPKIPISANISRVFIYGSYGATLPQI 192 I+ + +MWAPDIYEGSP PVTAFLSIAPKI I ANI RVFIYGSYGATL QI Sbjct: 230 ITAVPFHMWAPDIYEGSPTPVTAFLSIAPKISIFANILRVFIYGSYGATLQQI 282
BLAST of CX077922 vs. ExPASy Swiss-Prot
Match: NU2M_ARATH (NADH-ubiquinone oxidoreductase chain 2 OS=Arabidopsis thaliana GN=ND2 PE=2 SV=2) HSP 1 Score: 86.2705 bits (212), Expect = 5.421e-17 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 1 Query: 34 ISLLTLYMWAPDIYEGSPPPVTAFLSIAPKIPISANISRVFIYGSYGATLPQI 192 I+ + +MWAPDIYEGSP PVTAFLSIAPKI I ANI RVFIYGSYGATL QI Sbjct: 241 ITAVPFHMWAPDIYEGSPTPVTAFLSIAPKISIFANILRVFIYGSYGATLQQI 293
BLAST of CX077922 vs. ExPASy Swiss-Prot
Match: NU2M_MARPO (NADH-ubiquinone oxidoreductase chain 2 OS=Marchantia polymorpha GN=ND2 PE=3 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 3.404e-11 Identity = 32/53 (60.38%), Postives = 38/53 (71.70%), Query Frame = 1 Query: 34 ISLLTLYMWAPDIYEGSPPPVTAFLSIAPKIPISANISRVFIYGSYGATLPQI 192 I+ + +MWAPD+YEGSP VTAF SIAPKI I AN+ RVFIY Y T Q+ Sbjct: 231 ITAVPFHMWAPDVYEGSPTIVTAFFSIAPKISILANMLRVFIYSFYDPTWQQL 283 The following BLAST results are available for this feature:
BLAST of CX077922 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX077922 ID=CX077922; Name=CX077922; organism=Citrus sinensis; type=EST; length=194bpback to top |