CX069952
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX069952 vs. ExPASy Swiss-Prot
Match: PSAEB_NICSY (Photosystem I reaction center subunit IV B, chloroplastic OS=Nicotiana sylvestris GN=PSAEB PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.616e-13 Identity = 33/37 (89.19%), Postives = 36/37 (97.30%), Query Frame = 1 Query: 16 LDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 126 +DQDP +RYPVVVRFNKVNYANVSTNNYALDE+EEVK Sbjct: 107 VDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK 143
BLAST of CX069952 vs. ExPASy Swiss-Prot
Match: PSAEA_NICSY (Photosystem I reaction center subunit IV A, chloroplastic OS=Nicotiana sylvestris GN=PSAEA PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.616e-13 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 19 DQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 126 DQDP +RYPVVVRFNKVNYANVSTNNYALDEIEEVK Sbjct: 106 DQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEVK 141
BLAST of CX069952 vs. ExPASy Swiss-Prot
Match: PSAE_SPIOL (Photosystem I reaction center subunit IV, chloroplastic OS=Spinacia oleracea GN=PSAE-1 PE=1 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 6.169e-13 Identity = 33/36 (91.67%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 16 LDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV 123 +DQDPK+RYPVVVRFNKVNYANVSTNNYALDEI+EV Sbjct: 89 VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEV 124
BLAST of CX069952 vs. ExPASy Swiss-Prot
Match: PSAE2_ARATH (Photosystem I reaction center subunit IV B, chloroplastic OS=Arabidopsis thaliana GN=PSAE2 PE=1 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.052e-12 Identity = 32/37 (86.49%), Postives = 36/37 (97.30%), Query Frame = 1 Query: 16 LDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 126 +DQDPK+RYPVVVRF KVNYAN+STNNYALDE+EEVK Sbjct: 109 VDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEVK 145
BLAST of CX069952 vs. ExPASy Swiss-Prot
Match: PSAE1_ARATH (Photosystem I reaction center subunit IV A, chloroplastic OS=Arabidopsis thaliana GN=PSAE1 PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.999e-12 Identity = 31/36 (86.11%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 16 LDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV 123 +DQDPK+RYPVVVRF KVNYAN+STNNYALDE+EEV Sbjct: 106 VDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV 141 The following BLAST results are available for this feature:
BLAST of CX069952 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX069952 ID=CX069952; Name=CX069952; organism=Citrus sinensis; type=EST; length=329bpback to top |