DR404096
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.489e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.489e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.489e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.489e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.489e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.489e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 477 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 512
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.489e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 472 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 507
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_BRANA (Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 2.489e-13 Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 3.251e-13 Identity = 35/36 (97.22%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLEN+LRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENVLRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2) HSP 1 Score: 73.559 bits (179), Expect = 4.246e-13 Identity = 35/36 (97.22%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNALSKQRAMLENILRACVGLAPENNMI+EYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMIMEYK 510 The following BLAST results are available for this feature:
BLAST of DR404096 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 15
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DR404096 ID=DR404096; Name=DR404096; organism=Citrus sinensis; type=EST; length=444bpback to top |