EY693131
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY693131 vs. ExPASy Swiss-Prot
Match: RER1A_ARATH (Protein RER1A OS=Arabidopsis thaliana GN=RER1A PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.246e-14 Identity = 34/36 (94.44%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 13 VPVFWPILLCYWIVLFVLTMRRQIAHMIKYRYIPFN 120 VPVFWPILLCYWIVLFVLTMRRQIAHMIKY+YIPF+ Sbjct: 139 VPVFWPILLCYWIVLFVLTMRRQIAHMIKYKYIPFS 174
BLAST of EY693131 vs. ExPASy Swiss-Prot
Match: RER1B_ARATH (Protein RER1B OS=Arabidopsis thaliana GN=RER1B PE=2 SV=2) HSP 1 Score: 78.1814 bits (191), Expect = 2.126e-14 Identity = 33/37 (89.19%), Postives = 37/37 (100.00%), Query Frame = 1 Query: 13 VPVFWPILLCYWIVLFVLTMRRQIAHMIKYRYIPFNI 123 VPVFWPILLCYW+VLFVLTMRRQIAHMIK++YIPF+I Sbjct: 138 VPVFWPILLCYWVVLFVLTMRRQIAHMIKHKYIPFSI 174
BLAST of EY693131 vs. ExPASy Swiss-Prot
Match: RER1C_ARATH (Protein RER1C OS=Arabidopsis thaliana GN=RER1C PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.290e-11 Identity = 28/36 (77.78%), Postives = 33/36 (91.67%), Query Frame = 1 Query: 13 VPVFWPILLCYWIVLFVLTMRRQIAHMIKYRYIPFN 120 VPVFWPILL YW++LF LTMR+QI HMIKYRY+PF+ Sbjct: 160 VPVFWPILLFYWVMLFFLTMRKQIQHMIKYRYVPFS 195
BLAST of EY693131 vs. ExPASy Swiss-Prot
Match: RER1_YEAST (Protein RER1 OS=Saccharomyces cerevisiae GN=RER1 PE=1 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 8.359e-11 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 13 VPVFWPILLCYWIVLFVLTMRRQIAHMIKYRYIPFNI 123 +PVFWPILL Y+I+LF LTMRRQI HMIKYRYIP +I Sbjct: 142 IPVFWPILLMYFILLFFLTMRRQIQHMIKYRYIPLDI 178 The following BLAST results are available for this feature:
BLAST of EY693131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY693131 ID=EY693131; Name=EY693131; organism=Citrus sinensis; type=EST; length=479bpback to top |