CX053675
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX053675 vs. ExPASy Swiss-Prot
Match: SNAK2_SOLTU (Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1) HSP 1 Score: 96.6709 bits (239), Expect = 3.893e-20 Identity = 38/49 (77.55%), Postives = 43/49 (87.76%), Query Frame = -2 Query: 169 LSSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 315 LSSRP LC+RACGTCCARC CVPPGTSG+ E CPCYA++TTH +RKCP Sbjct: 56 LSSRPRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP 104
BLAST of CX053675 vs. ExPASy Swiss-Prot
Match: GASA1_ARATH (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana GN=GASA1 PE=1 SV=2) HSP 1 Score: 91.2781 bits (225), Expect = 1.635e-18 Identity = 36/49 (73.47%), Postives = 40/49 (81.63%), Query Frame = -2 Query: 169 LSSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 315 LS RP LCHRACGTCC RC CVPPGT G+ + C CYA++TTH GRRKCP Sbjct: 50 LSRRPRLCHRACGTCCYRCNCVPPGTYGNYDKCQCYASLTTHGGRRKCP 98
BLAST of CX053675 vs. ExPASy Swiss-Prot
Match: GASA2_ARATH (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana GN=GASA2 PE=2 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 1.999e-16 Identity = 33/48 (68.75%), Postives = 39/48 (81.25%), Query Frame = -2 Query: 169 SSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 312 SSR LC RAC +CC+RC CVPPGTSG+ +CPCYA++TTH GR KCP Sbjct: 52 SSRTKLCLRACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCP 99
BLAST of CX053675 vs. ExPASy Swiss-Prot
Match: GASA3_ARATH (Gibberellin-regulated protein 3 OS=Arabidopsis thaliana GN=GASA3 PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 3.410e-16 Identity = 33/48 (68.75%), Postives = 39/48 (81.25%), Query Frame = -2 Query: 169 SSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 312 SSRPNLC RAC +CC RC CVPPGT+G+ +CPCYA++TT GR KCP Sbjct: 52 SSRPNLCLRACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP 99 The following BLAST results are available for this feature:
BLAST of CX053675 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX053675 ID=CX053675; Name=CX053675; organism=Citrus sinensis; type=EST; length=319bpback to top |