DR403419

Overview
NameDR403419
Unique NameDR403419
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length731
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANXD5_ARATH (Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 3.764e-41
Identity = 88/191 (46.07%), Postives = 126/191 (65.97%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSL--TTGSLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAKVWARTI 572
            L SEL G L+ AVLLWM +   RDA +++ SL       KA  E+IC+R+ SQ++ I+Q Y + FGV LE+DI+   SG+H+++LLAY++    EG E+D   VENDA+ L  A  ++  +D++T I+IF +RSR HL  V   Y SM+G  L K ++ ET GNFE+ LLTIL+C+EN   YFAK   +++
Sbjct:   65 LHSELHGHLKKAVLLWMPEAVERDASILKRSLRGAVTDHKAIAEIICTRSGSQLRQIKQVYSNTFGVKLEEDIESEASGNHKRVLLAYLNTTRYEGPEIDNASVENDARTLKSAVARKHKSDDQTLIQIFTDRSRTHLVAVRSTYRSMYGKELGKAIRDETRGNFEHVLLTILQCAENSCFYFAKALRKSM 255          

HSP 2 Score: 87.4261 bits (215), Expect = 8.443e-17
Identity = 43/70 (61.43%), Postives = 55/70 (78.57%), Query Frame = 2
Query:  518 KMLRESCEVFREGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLGP 727
            K LR+S +    GLGTDDT L+R++VTR E+DMQ+I  EY K+YKKTL +AV  +T+ +YRTFLLSLLGP
Sbjct:  249 KALRKSMK----GLGTDDTALIRIVVTRAEVDMQFIITEYRKRYKKTLYNAVHSDTTSHYRTFLLSLLGP 314          

HSP 3 Score: 49.6766 bits (117), Expect = 2.174e-11
Identity = 36/129 (27.91%), Postives = 56/129 (43.41%), Query Frame = 3
Query:  132 VICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTIL 518
            ++  R  +Q  LI Q Y +KF   L   +     G  +K +L ++            + VE DA  L K   +   TD +    I C RS + L  +  VY +  G  L++ ++ E SGN +  LL  L
Sbjct:   37 ILAHRNATQRALIEQEYETKFSDDLRKRLHSELHGHLKKAVLLWMP-----------EAVERDASIL-KRSLRGAVTDHKAIAEIICTRSGSQLRQIKQVYSNTFGVKLEEDIESEASGNHKRVLLAYL 153          

HSP 4 Score: 39.2762 bits (90), Expect = 2.174e-11
Identity = 17/53 (32.08%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  563 TDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLL 721
            +DD TL+++   R+   +  +++ Y   Y K L  A+  ET GN+   LL++L
Sbjct:  185 SDDQTLIQIFTDRSRTHLVAVRSTYRSMYGKELGKAIRDETRGNFEHVLLTIL 237          
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANXA4_PIG (Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 7.262e-40
Identity = 68/185 (36.76%), Postives = 104/185 (56.22%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSLTTGSLKAAT--EVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAK 554
            L SEL G  E  +L  M      D   +R ++           E++ SRTP +I+ I Q Y  ++G  LEDDI+  TS   +++L++  +   +EG  +D  +V  DA+ LY+AGEK+ GTDE  F+ + C R+R HL +V   Y  +    +++ +K ETSG+FE  LL I+KC  N + YFA+
Sbjct:   68 LKSELSGNFEQVILGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAE 252          

HSP 2 Score: 62.7734 bits (151), Expect = 7.262e-40
Identity = 30/58 (51.72%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  551 EGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLG 724
            +GLGTDD TL+RV+V+R EIDM  I+A + + Y K+L   +  +TSG+YR  LL L G
Sbjct:  259 KGLGTDDNTLIRVMVSRAEIDMMDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCG 316          
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANXA4_HUMAN (Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4)

HSP 1 Score: 121.324 bits (303), Expect = 2.093e-39
Identity = 67/185 (36.22%), Postives = 104/185 (56.22%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSLTTGSLKAAT--EVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAK 554
            L SEL G  E  ++  M      D   +R ++           E++ SRTP +I+ I Q Y  ++G  LEDDI+  TS   +++L++  +   +EG  +D  +V  DA+ LY+AGEK+ GTDE  F+ + C R+R HL +V   Y  +    +++ +K ETSG+FE  LL I+KC  N + YFA+
Sbjct:   68 LKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAE 252          

HSP 2 Score: 62.003 bits (149), Expect = 2.093e-39
Identity = 30/58 (51.72%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  551 EGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLG 724
            +GLGTDD TL+RV+V+R EIDM  I+A + + Y K+L   +  +TSG+YR  LL L G
Sbjct:  259 KGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCG 316          
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANXA7_BOVIN (Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 1.729e-38
Identity = 70/185 (37.84%), Postives = 98/185 (52.97%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSLTTGSL--KAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAK 554
            L SEL G +E  +L         DA  +RN++       +   E++C+RT  +I+ I + Y S+FG  LE DI+  TSG  E+LL++      +E   V+ Q+ + DA+ LY+AGE RLGTDE  F  I   RS   L      Y  M    L   V +E SGN E GL TIL+C+ N   +FA+
Sbjct:  214 LKSELSGNMEELILALFMPSTYYDAWSLRNAMKGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQNVNHQLAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLNSVSREFSGNVESGLKTILQCALNRPAFFAE 398          

HSP 2 Score: 67.0106 bits (162), Expect = 1.729e-38
Identity = 30/58 (51.72%), Postives = 45/58 (77.59%), Query Frame = 2
Query:  551 EGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLG 724
            +G GTDD+TLVR++VTR+EID+  IK  +S+ Y+KTL   +  +TSG+YR  LL+++G
Sbjct:  405 KGAGTDDSTLVRIVVTRSEIDLVQIKQMFSQMYQKTLGTMIASDTSGDYRKLLLAIVG 462          
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANXA4_BOVIN (Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 2.263e-38
Identity = 66/185 (35.68%), Postives = 103/185 (55.68%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSLTTGSLKAAT--EVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAK 554
            L SEL G  E  +L  M      D   +R ++           E++ SRTP +I+ I Q Y  ++G  LEDDI+  TS   +++L++  +   +E   +D  ++  DA+ LY+AGEK+ GTDE  F+ + C R+R HL +V   Y  +    +++ +K ETSG+FE  LL I+KC  N + YFA+
Sbjct:   68 LKSELSGNFEQVILGMMTPTVLYDVQELRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAE 252          

HSP 2 Score: 61.6178 bits (148), Expect = 2.263e-38
Identity = 30/58 (51.72%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  551 EGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLG 724
            +GLGTDD TL+RV+V+R EIDM  I+A + + Y K+L   +  +TSG+YR  LL L G
Sbjct:  259 KGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCG 316          
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANXA4_RAT (Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3)

HSP 1 Score: 116.701 bits (291), Expect = 8.493e-38
Identity = 67/185 (36.22%), Postives = 100/185 (54.05%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSLTTGSLKAAT--EVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAK 554
            L SEL    E  +L  M      D   +R ++           E++ SR P +I+ I Q Y  ++G  LE+DI   TS   +++L++  +   +EG  +D  +V  DA+ LY+AGEKR GTDE  F+ I C R+R HL +V   Y  +    +++ +K ETSG+FE  LL I+KC  N   YFA+
Sbjct:   68 LKSELSSNFEQVILGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRNPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLTAGGRDEGNYLDDALVRQDAQDLYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKPAYFAE 252          

HSP 2 Score: 61.2326 bits (147), Expect = 8.493e-38
Identity = 30/58 (51.72%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  551 EGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLG 724
            +GLGTDD+TL+RV+V+R EIDM  I A + + Y K+L   +  +TSG+YR  LL L G
Sbjct:  259 KGLGTDDSTLIRVMVSRAEIDMLDIPANFKRVYGKSLYSFIKGDTSGDYRKVLLILCG 316          
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANX11_RABIT (Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.100e-37
Identity = 66/185 (35.68%), Postives = 101/185 (54.59%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSLTTGSLKAAT--EVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAK 554
            L SEL G  E  +L  M  P   DA  ++ ++       A   E++ SR+   I+ + + Y ++F   LE+ I+  TSG  ++LL++      +E   VD  +V+ D + LY AGE RLGTDE  F  + C RSRAHL  V   Y  M G  ++K + +E SG+ E G+L ++KC +N   +FA+
Sbjct:  252 LKSELSGNFEKTILALMKTPILFDAYEIKEAIKGAGTDEACLIEILASRSNEHIRELNKAYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGMLAVVKCLKNTPAFFAE 436          

HSP 2 Score: 59.3066 bits (142), Expect = 1.100e-37
Identity = 27/57 (47.37%), Postives = 40/57 (70.18%), Query Frame = 2
Query:  554 GLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLG 724
            G GT D TL+R++V+R+EID+  I+AEY + Y K+L   +  +TSG+YR  LL + G
Sbjct:  444 GAGTKDRTLIRIMVSRSEIDLLDIRAEYKRMYGKSLYHDISGDTSGDYRKILLKICG 500          
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANXA7_HUMAN (Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3)

HSP 1 Score: 111.694 bits (278), Expect = 1.100e-37
Identity = 69/185 (37.30%), Postives = 97/185 (52.43%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSLTTGSL--KAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAK 554
            L SEL G +E  +L     P   DA  +R ++       +   E++C+RT  +I+ I + Y S+FG  LE DI+  TSG  E+LL++      +E   ++ QM + DA+ LY+AGE RLGTDE  F  I   RS   L      Y  M    L   V +E SG  E GL TIL+C+ N   +FA+
Sbjct:  239 LKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAE 423          

HSP 2 Score: 65.855 bits (159), Expect = 1.100e-37
Identity = 29/58 (50.00%), Postives = 45/58 (77.59%), Query Frame = 2
Query:  551 EGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLG 724
            +G GTDD+TLVR++VTR+EID+  IK  +++ Y+KTL   +  +TSG+YR  LL+++G
Sbjct:  430 KGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVG 487          

HSP 3 Score: 68.5514 bits (166), Expect = 8.881e-14
Identity = 46/150 (30.67%), Postives = 76/150 (50.67%), Query Frame = 3
Query:   72 RDAVVMRNSLTTGSL--KAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTI 515
            RDA ++R ++       +A  +V+ +R+  Q Q I+  + + +G  L  D+K   SG+ E+L+LA   PP              DA +L KA  +  GT ER  I I C R+   +  +   Y S  G  L+K ++ +TSG+FE  L+++
Sbjct:  189 RDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPP-----------TYYDAWSLRKA-MQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSM 326          

HSP 4 Score: 28.4906 bits (62), Expect = 8.881e-14
Identity = 19/74 (25.68%), Postives = 38/74 (51.35%), Query Frame = 2
Query:  512 NFKMLRESCE-VFREG---LGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLL 721
            N +M +E  + +++ G   LGTD++    ++ TR+   ++     YS+   + L  +V  E SG   + L ++L
Sbjct:  338 NHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTIL 411          
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANX11_BOVIN (Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.433e-37
Identity = 67/185 (36.22%), Postives = 101/185 (54.59%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSLTTGSLKAAT--EVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAK 554
            L SEL G  E  +L  M  P   DA  ++ ++       A   E++ SR+   I+ + + Y ++F   LE+ I+  TSG  ++LL++      +E   VD  +V+ D + LY AGE RLGTDE  F  I C RSRAHL  V   Y  M G  ++K + +E SG+ E G+L ++KC +N   +FA+
Sbjct:  252 LKSELSGNFEKTILALMKTPVLFDAYEIKEAIKGAGTDEACLIEILASRSNEHIRELNRVYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMTLVQRDVQELYAAGENRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGMLAVVKCLKNTPAFFAE 436          

HSP 2 Score: 58.9214 bits (141), Expect = 1.433e-37
Identity = 27/57 (47.37%), Postives = 40/57 (70.18%), Query Frame = 2
Query:  554 GLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLG 724
            G GT D TL+R++V+R+EID+  I+AEY + Y K+L   +  +TSG+YR  LL + G
Sbjct:  444 GAGTKDRTLIRIMVSRSEIDLLDIRAEYKRLYGKSLYHDITGDTSGDYRKILLKICG 500          
BLAST of DR403419 vs. ExPASy Swiss-Prot
Match: ANXA7_MACFA (Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.433e-37
Identity = 70/185 (37.84%), Postives = 97/185 (52.43%), Query Frame = 3
Query:    6 LXSELIGKLEMAVLLWMHDPAGRDAVVMRNSLTTGSL--KAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFAK 554
            L SEL G +E  +L     P   DA  +R ++       +   E++C+RT  +I+ I + Y S+FG  LE DI+  TSG  E+LL++      +E   V+ QM + DA+ LY+AGE RLGTDE  F  I   RS   L      Y  M    L   V +E SG  E GL TIL+C+ N   +FA+
Sbjct:  239 LKSELSGNMEELILALFMPPTYYDAWTLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAE 423          

HSP 2 Score: 64.3142 bits (155), Expect = 1.433e-37
Identity = 29/58 (50.00%), Postives = 45/58 (77.59%), Query Frame = 2
Query:  551 EGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLLG 724
            +G GTDD+TLVR++VTR+EID+  IK  +++ Y+KTL   +  +TSG+YR  LL+++G
Sbjct:  430 KGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRPLLAIVG 487          

HSP 3 Score: 68.5514 bits (166), Expect = 8.881e-14
Identity = 47/152 (30.92%), Postives = 76/152 (50.00%), Query Frame = 3
Query:   66 AGRDAVVMRNSLTTGSL--KAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKLLLAYVSPPWNEGLEVDGQMVENDAKALYKAGEKRLGTDERTFIRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTI 515
            A RDA ++R ++       +A  +V+ +R+  Q Q I+  + + +G  L  D+K   SG+ E+L+LA   PP              DA  L KA  +  GT ER  I I C R+   +  +   Y S  G  L+K ++ +TSG+FE  L+++
Sbjct:  187 AMRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPP-----------TYYDAWTLRKA-MQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSM 326          

HSP 4 Score: 28.4906 bits (62), Expect = 8.881e-14
Identity = 19/74 (25.68%), Postives = 38/74 (51.35%), Query Frame = 2
Query:  512 NFKMLRESCE-VFREG---LGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVXXETSGNYRTFLLSLL 721
            N +M +E  + +++ G   LGTD++    ++ TR+   ++     YS+   + L  +V  E SG   + L ++L
Sbjct:  338 NHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTIL 411          
The following BLAST results are available for this feature:
BLAST of DR403419 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 86
Match NameE-valueIdentityDescription
ANXD5_ARATH3.764e-4146.07Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV... [more]
ANXA4_PIG7.262e-4036.76Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2[more]
ANXA4_HUMAN2.093e-3936.22Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4[more]
ANXA7_BOVIN1.729e-3837.84Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2[more]
ANXA4_BOVIN2.263e-3835.68Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2[more]
ANXA4_RAT8.493e-3836.22Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3[more]
ANX11_RABIT1.100e-3735.68Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=... [more]
ANXA7_HUMAN1.100e-3737.30Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3[more]
ANX11_BOVIN1.433e-3736.22Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1[more]
ANXA7_MACFA1.433e-3737.84Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV... [more]

Pages

back to top
Libraries
Library NameType
Flavedo Maturecdna_library
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244P12 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244P12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403419 ID=DR403419|Name=DR403419|organism=Citrus sinensis|type=EST|length=731bp
GGGGCTTGNNTTCAGAGCTTATTGGCAAATTGGAGATGGCAGTTTTGCTC
TGGATGCATGACCCAGCAGGACGTGATGCAGTAGTTATGAGAAATTCACT
TACCACAGGTAGTTTAAAAGCTGCCACTGAAGTAATTTGTTCTCGCACAC
CATCCCAGATTCAGTTGATTAGACAACATTACCATTCAAAGTTTGGCGTC
CACCTTGAAGATGATATTAAGAGACACACTTCTGGTGATCATGAAAAGCT
CTTGTTGGCATATGTGAGCCCCCCTTGGAATGAAGGTCTGGAAGTTGACG
GACAAATGGTTGAGAATGATGCCAAGGCACTTTACAAAGCTGGGGAGAAG
AGATTAGGAACTGATGAGAGGACTTTCATTCGGATATTCTGTGAACGAAG
CAGGGCACATTTGGCTTATGTTGCTCCTGTTTATCACAGTATGCATGGAA
ACTCACTTAAAAAGGTGGTGAAGAAGGAAACATCGGGCAATTTTGAGTAT
GGTCTTTTGACAATTTTAAAATGCTCAGAGAATCCTGCGAAGTATTTCGC
GAAGGTCTGGGCACGGACGATACTACACTGGTAAGGGTTATTGTGACTAG
AACTGAGATTGATATGCAGTATATAAAAGCTGAGTACTCGAAGAAATACA
AGAAGACCTTGACTGATGCTGTTCANNNNGAAACATCAGGCAATTACCGG
ACTTTTCTTCTCTCTCTTTTGGGTCCCAAAT
back to top