DR403418

Overview
NameDR403418
Unique NameDR403418
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length624
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig672 contig Csv1_Contig672:39..662. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB6_ARATH (Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2)

HSP 1 Score: 308.916 bits (790), Expect = 1.325e-83
Identity = 150/177 (84.75%), Postives = 163/177 (92.09%), Query Frame = 2
Query:   92 MDLKMEDFNAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSL 622
            MDL ++   APHSMGTTIIGVTYNGGVVLGADSRTSTG+YVANRASDKITQLTDNVY+CRSGSAADSQ VSDYVRYFLHQHTIQ GQPATVKV+ANL+R+L+YNNKN LQTG+IVGGWDKYEGGKIYG+PLGGT++EQPFAI      YLYGFFDQAWK+ MTKEEAEQLVVKAVSL
Sbjct:    1 MDLNLD---APHSMGTTIIGVTYNGGVVLGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQVVSDYVRYFLHQHTIQHGQPATVKVSANLIRMLAYNNKNMLQTGLIVGGWDKYEGGKIYGIPLGGTVVEQPFAIGGSGSSYLYGFFDQAWKDNMTKEEAEQLVVKAVSL 174          
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB6_TOBAC (Proteasome subunit beta type-6 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.264e-82
Identity = 148/171 (86.55%), Postives = 158/171 (92.40%), Query Frame = 2
Query:  110 DFNAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSL 622
            D + PHSMGTTIIGVTYNGGVVLGADSRTSTG+YVANRASDKITQLTDNVY+CRSGSAADSQ VSDYVRYFLHQHTIQLGQPATVKVAANL RLLSYNNK+ LQTGMI+GGWDKYEGGKIYG+P GGT++EQPFAI      YLYGFFDQAWKEGMT+EEAE+LVV AVSL
Sbjct:    5 DVDQPHSMGTTIIGVTYNGGVVLGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQIVSDYVRYFLHQHTIQLGQPATVKVAANLTRLLSYNNKDRLQTGMIIGGWDKYEGGKIYGIPPGGTVLEQPFAIGGSGSSYLYGFFDQAWKEGMTQEEAEKLVVTAVSL 175          
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB6_DICDI (Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 4.452e-47
Identity = 84/164 (51.22%), Postives = 121/164 (73.78%), Query Frame = 2
Query:  131 MGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSL 622
            +GT+I+ V Y+GGV++GADSRT+TG Y+ANR ++KIT + + +Y CRSGSAAD+Q +SDYVRY+L  HT +L     VK AA+L +LL Y+NKN L  G+IV GWDK++GG +Y + LGG++++QPFAI      Y+YG+ D  +K  MTK+E  + V  +++L
Sbjct:   13 LGTSIMAVEYDGGVIMGADSRTTTGAYIANRVTNKITPIHERIYCCRSGSAADTQAISDYVRYYLEMHTSELCDEPDVKTAASLFQLLCYSNKNNLMAGIIVAGWDKHQGGSVYNISLGGSMVKQPFAIGGSGSTYIYGYCDSKFKPKMTKDECIEFVQNSLAL 176          
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB6_BOVIN (Proteasome subunit beta type-6 OS=Bos taurus GN=PSMB6 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.212e-44
Identity = 84/169 (49.70%), Postives = 116/169 (68.64%), Query Frame = 2
Query:  116 NAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSL 622
            N   S GTTI+ V ++GGVVLGADSRT+TG Y+ANR +DK+T + D ++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ QPFAI      Y+YG+ D  ++EGMTKEE  Q    A++L
Sbjct:   28 NREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQPFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALAL 196          
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB6_MOUSE (Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3)

HSP 1 Score: 177.563 bits (449), Expect = 4.607e-44
Identity = 83/169 (49.11%), Postives = 116/169 (68.64%), Query Frame = 2
Query:  116 NAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSL 622
            N   S GTTI+ V +NGGVVLGADSRT+TG Y+ANR +DK+T + D+++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ Q FAI      Y+YG+ D  ++EGMTK+E  Q    A++L
Sbjct:   27 NREVSTGTTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALAL 195          
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB6_SCHPO (Probable proteasome subunit beta type-6 OS=Schizosaccharomyces pombe GN=SPBC4C3.10c PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.340e-43
Identity = 82/164 (50.00%), Postives = 114/164 (69.51%), Query Frame = 2
Query:  131 MGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSL 622
            MGTTI  + Y  GV+L ADSRT+ G Y+ANR +DK+TQLTDN++ CRSGSAAD+QTV+D ++Y+L  + IQ G   +V  AA L   + Y NKN L  G+IV G+D+  GG +Y +PLGG++ +QP AI      ++YGF D  ++E MT+EEA + +  AV+L
Sbjct:   23 MGTTITALRYKDGVILAADSRTTMGAYIANRVTDKLTQLTDNIWCCRSGSAADTQTVADLLKYYLSMYRIQFGHDPSVHTAATLASEMCYQNKNMLSAGLIVAGYDEKTGGDVYSIPLGGSLHKQPLAIGGSGSAFIYGFCDANFRENMTQEEAVEFLKNAVAL 186          
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB6_HUMAN (Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4)

HSP 1 Score: 176.022 bits (445), Expect = 1.340e-43
Identity = 82/165 (49.70%), Postives = 114/165 (69.09%), Query Frame = 2
Query:  128 SMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSL 622
            S GTTI+ V ++GGVVLGADSRT+TG Y+ANR +DK+T + D ++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ Q FAI      Y+YG+ D  ++EGMTKEE  Q    A++L
Sbjct:   32 STGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALAL 196          
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB6_RAT (Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3)

HSP 1 Score: 175.637 bits (444), Expect = 1.751e-43
Identity = 82/169 (48.52%), Postives = 116/169 (68.64%), Query Frame = 2
Query:  116 NAPHSMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSL 622
            N   S GTTI+ V ++GGVVLGADSRT+TG Y+ANR +DK+T + D+++ CRSGSAAD+Q V+D V Y L  H+I+L +P  V  AA+L + + Y  +  L  G+I+ GWD  EGG++Y VP+GG ++ Q FAI      Y+YG+ D  ++EGMTK+E  Q    A++L
Sbjct:   27 NREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALAL 195          
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB6_YEAST (Proteasome component PRE3 OS=Saccharomyces cerevisiae GN=PRE3 PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 4.934e-38
Identity = 73/164 (44.51%), Postives = 116/164 (70.73%), Query Frame = 2
Query:  128 SMGTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVS 619
            S+GT+I+ VT+  GV+LGADSRT+TG Y+ANR +DK+T++ D ++ CRSGSAAD+Q ++D V+Y L  +T Q G P+T + AA++ + L Y NK+ L  G+IV G+D    G++Y +PLGG++ + P+AI      ++YG+ D+ ++E M+KEE    +  ++S
Sbjct:   17 SLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPST-ETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLS 179          
BLAST of DR403418 vs. ExPASy Swiss-Prot
Match: PSB9_ORYLA (Proteasome subunit beta type-9 OS=Oryzias latipes GN=psmb9 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.073e-36
Identity = 74/163 (45.40%), Postives = 107/163 (65.64%), Query Frame = 2
Query:  134 GTTIIGVTYNGGVVLGADSRTSTGVYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVRLLSYNNKNFLQTGMIVGGWDKYEGGKIYGVPLGGTIIEQPFAIXXXXXXYLYGFFDQAWKEGMTKEEAEQLVVKAVSL 622
            GTTII + +NGGVVLG+DSR S G  V NR  +K++ L D +Y   SGSAAD+QT+++ V Y L  H++++ +   V+ AA LV+ +SY  K  L   +IV GWD+ +GG+++   LGG +  QPFAI      Y+YGF D  ++ GMTKEE ++ VV  ++L
Sbjct:   18 GTTIIAIEFNGGVVLGSDSRVSAGDSVVNRVMNKLSPLHDKIYCALSGSAADAQTIAEMVNYQLDVHSLEIDEDPQVRSAATLVKNISYKYKEELSAHLIVAGWDRRDGGQVFAT-LGGLLTRQPFAIGGSGSSYVYGFVDAEYRRGMTKEECQKFVVNTLAL 179          
The following BLAST results are available for this feature:
BLAST of DR403418 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
PSB6_ARATH1.325e-8384.75Proteasome subunit beta type-6 OS=Arabidopsis thal... [more]
PSB6_TOBAC3.264e-8286.55Proteasome subunit beta type-6 OS=Nicotiana tabacu... [more]
PSB6_DICDI4.452e-4751.22Proteasome subunit beta type-6 OS=Dictyostelium di... [more]
PSB6_BOVIN1.212e-4449.70Proteasome subunit beta type-6 OS=Bos taurus GN=PS... [more]
PSB6_MOUSE4.607e-4449.11Proteasome subunit beta type-6 OS=Mus musculus GN=... [more]
PSB6_SCHPO1.340e-4350.00Probable proteasome subunit beta type-6 OS=Schizos... [more]
PSB6_HUMAN1.340e-4349.70Proteasome subunit beta type-6 OS=Homo sapiens GN=... [more]
PSB6_RAT1.751e-4348.52Proteasome subunit beta type-6 OS=Rattus norvegicu... [more]
PSB6_YEAST4.934e-3844.51Proteasome component PRE3 OS=Saccharomyces cerevis... [more]
PSB9_ORYLA2.073e-3645.40Proteasome subunit beta type-9 OS=Oryzias latipes ... [more]

Pages

back to top
Libraries
Library NameType
Flavedo Maturecdna_library
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244P11 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244P11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403418 ID=DR403418|Name=DR403418|organism=Citrus sinensis|type=EST|length=624bp
GGGGACAAGAAGCAAAAATTAAAATTAAACTCAAAATTAAAATTGTTAAG
GGCATTTAGAAATTGTGGTAAGTGAGTGTTTTAGAGGAAAGATGGATCTG
AAGATGGAAGATTTTAACGCGCCACACTCGATGGGTACTACTATCATCGG
CGTCACTTACAACGGCGGCGTTGTCCTCGGCGCCGATTCTCGTACTAGCA
CCGGGGTGTATGTTGCTAACCGAGCTTCAGACAAGATTACGCAGCTCACT
GATAATGTCTACCTTTGCCGCTCGGGATCGGCTGCAGATTCTCAGACTGT
CTCCGACTATGTTCGCTACTTCCTTCATCAACACACGATACAGCTAGGGC
AGCCTGCAACTGTTAAAGTTGCTGCCAATCTTGTCAGGCTGCTATCCTAC
AATAACAAGAACTTTTTGCAAACTGGAATGATTGTTGGCGGTTGGGATAA
GTATGAAGGTGGTAAAATATATGGAGTTCCTCTTGGAGGAACAATAATTG
AGCAGCCTTTTGCAATTGGAGGATCTGGCTCAAGTTACCTGTATGGGTTT
TTTGATCAGGCATGGAAAGAGGGAATGACCAAGGAAGAAGCTGAGCAATT
AGTGGTTAAAGCAGTTTCTCTTGC
back to top