DN617290

Overview
NameDN617290
Unique NameDN617290
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length624
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7350 contig Csv1_Contig7350:71..693. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: PRXQ_POPJC (Peroxiredoxin Q, chloroplastic OS=Populus jackii GN=PRXQ PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 5.567e-82
Identity = 152/195 (77.95%), Postives = 167/195 (85.64%), Query Frame = 2
Query:   38 ASLNLPKHTLPPFLXXXXXXXXXXXXLAIPSKSSSQSQFYGLGFSFSSNLPIPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNEVVQLIYNN 622
            AS++LPKH+LP  L            L I SKSS QSQFYGL FS S++L IPSS+S K +I AKV+KGQAPPSFTLKDQ+G+ +SLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEV+GISGDD SSHKAFAKKYRLP+TLLSDEGNK+RKEWGVPAD FG+LPGRQTYVLDK  VVQLIYNN
Sbjct:    2 ASISLPKHSLPSLLPTLKPITSSSQNLPILSKSS-QSQFYGLKFSHSTSLSIPSSSSVKNTIFAKVNKGQAPPSFTLKDQDGKTLSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDPSSHKAFAKKYRLPFTLLSDEGNKIRKEWGVPADLFGTLPGRQTYVLDKKGVVQLIYNN 195          
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: PERQ_SEDLI (Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum lineare GN=PRXQ PE=1 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 4.724e-73
Identity = 132/164 (80.49%), Postives = 146/164 (89.02%), Query Frame = 2
Query:  131 KSSSQSQFYGLGFSFSSNLPIPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNEVVQLIYNN 622
            ++SSQSQF+GL FS +S+   PS+   K SI AKV+KG  PP FTLKDQEGR VSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEV+GISGD S SHKAFAKKY+LP+TLLSDEGNKVRKEWGVP+D FG+LPGR+TYVLDKN VVQL+YNN
Sbjct:    4 QTSSQSQFHGLKFSHASSFKSPSAPLRKNSIFAKVTKGSTPPPFTLKDQEGRPVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDSSESHKAFAKKYKLPFTLLSDEGNKVRKEWGVPSDLFGTLPGRETYVLDKNGVVQLVYNN 167          
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: PRXQ_GENTR (Peroxiredoxin Q, chloroplastic OS=Gentiana triflora GN=AFP1 PE=1 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 8.057e-73
Identity = 143/199 (71.86%), Postives = 155/199 (77.89%), Query Frame = 2
Query:   35 AASLNLPKHTLPPFLXXXXXXXXXXXXL-AIPSKSSSQSQFYGLGFSFSS--NLPIPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNEVVQLIYNN 622
            A  L + KH+ P  L            L  IP   SSQSQ  GL F  SS  +LP P S S + S+ AKVSKG  PP FTLKDQ+G+NVSL++FKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDD SSHKAFAKKYRLPYTLLSDEGNK+R+EWGVPAD FG+LPGRQTYVLDKN  VQLIYNN
Sbjct:    3 AICLPVAKHSFPSLLNTQTPKPLFSQNLHTIPL--SSQSQICGLKFLISSPSSLPPPPSYSARISVFAKVSKGSVPPQFTLKDQDGKNVSLTEFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDPSSHKAFAKKYRLPYTLLSDEGNKIRREWGVPADLFGTLPGRQTYVLDKNGTVQLIYNN 199          
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: PERQ_SUASA (Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=PRXQ PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 3.999e-72
Identity = 139/196 (70.92%), Postives = 159/196 (81.12%), Query Frame = 2
Query:   38 ASLNLPKHTLPPFLXXXXXXXXXXXXLAIPSKSSSQSQFYGLGFSFSSNLPIPS-STSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNEVVQLIYNN 622
            A+L+LP H+    L            L+I SKS+  SQF G+  S SS+L  P    S+K SI AKVS+G  PP+FTLKDQ+G+NVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAF +KY+LPYTLLSDEGNKVRK+WGVP+D FG+LPGRQTYVLD+N VV+L+YNN
Sbjct:    2 ATLSLPNHSPTFALPSQTPKPHSSQNLSIISKSA-HSQFCGIKLSHSSSLSPPLYPRSYKASIVAKVSEGSMPPAFTLKDQDGKNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFKQKYKLPYTLLSDEGNKVRKDWGVPSDLFGALPGRQTYVLDRNGVVRLVYNN 196          
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: PRXQ_ARATH (Peroxiredoxin Q, chloroplastic OS=Arabidopsis thaliana GN=PRXQ PE=1 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.422e-69
Identity = 129/168 (76.79%), Postives = 145/168 (86.31%), Query Frame = 2
Query:  119 AIPSKSSSQSQFYGLGFSFSSNLPIPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNEVVQLIYNN 622
            ++P+KSS +S F+G   + SS +   SS+S K  I AKV+KGQA P FTLKDQ G+ VSL K+KGKPVV+YFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDS+SHKAFA KY+LPYTLLSDEGNKVRK+WGVP D FG+LPGRQTYVLDKN VVQLIYNN
Sbjct:   32 SVPTKSS-ESNFFGSTLTHSSYISPVSSSSLKGLIFAKVNKGQAAPDFTLKDQNGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNN 198          
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: PRXQ_WHEAT (Peroxiredoxin Q, chloroplastic OS=Triticum aestivum GN=PRX1 PE=1 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.776e-65
Identity = 123/167 (73.65%), Postives = 139/167 (83.23%), Query Frame = 2
Query:  131 KSSSQSQFYGLGFSFSSNL--PIPSSTSFKTSI-SAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNEVVQLIYNN 622
            + S+ + F+GL    S+    P P   +  T I   KVSKG  PP+FTLKDQ+G+ VSLSKFKGKPVV+YFYPADETPGCTKQACAFRDSYEK+KKAGAEVIGISGDD++SHKAFAKKYRLP+TLLSDEGNKVRKEWGVP+D FG+LPGRQTYVLDK  VVQ IYNN
Sbjct:   33 RPSTSAAFHGLRAPASAFALAPAPRRRAASTGIVCGKVSKGSVPPNFTLKDQDGKTVSLSKFKGKPVVLYFYPADETPGCTKQACAFRDSYEKYKKAGAEVIGISGDDAASHKAFAKKYRLPFTLLSDEGNKVRKEWGVPSDLFGTLPGRQTYVLDKKGVVQYIYNN 199          
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: PRXQ_ORYSJ (Peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0196300 PE=1 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 4.735e-65
Identity = 117/144 (81.25%), Postives = 129/144 (89.58%), Query Frame = 2
Query:  191 IPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNEVVQLIYNN 622
            +PS+T     +  KVSKG A P+FTL+DQ+GR VSLSKFKG+PVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDD++SHK F KKY+LP+TLLSDEGNKVRKEWGVPAD FG+LPGRQTYVLDKN VVQ IYNN
Sbjct:   56 LPSTTGRNRIVCGKVSKGSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGVVQYIYNN 199          
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: PRXQ_ORYSI (Putative peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_22010 PE=1 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 4.735e-65
Identity = 117/144 (81.25%), Postives = 129/144 (89.58%), Query Frame = 2
Query:  191 IPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNEVVQLIYNN 622
            +PS+T     +  KVSKG A P+FTL+DQ+GR VSLSKFKG+PVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDD++SHK F KKY+LP+TLLSDEGNKVRKEWGVPAD FG+LPGRQTYVLDKN VVQ IYNN
Sbjct:   56 LPSTTGRNRIVCGKVSKGSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGVVQYIYNN 199          
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: BCP_COXBU (Putative peroxiredoxin bcp OS=Coxiella burnetii GN=bcp PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.347e-27
Identity = 60/133 (45.11%), Postives = 85/133 (63.91%), Query Frame = 2
Query:  233 VSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPAD---FFGSLPG--RQTYVLDKNEVVQLIY 616
            +  GQ  P FTL   EG  +SL   KGK V++YFYP D+TPGCTK+AC FRD + +  KAG  V+GIS D   +H++F +KY LP+TLLSD+ N V +++GV  D   F     G  R T+++D+  V+  ++
Sbjct:    3 IEVGQKAPIFTLPTDEGEMLSLDDLKGKKVILYFYPKDDTPGCTKEACGFRDVWSQLSKAGVVVLGISKDSVKAHQSFKQKYNLPFTLLSDKDNTVCEQYGVMVDKNRFGKKYKGIERTTFLIDEEGVISAVW 135          
BLAST of DN617290 vs. ExPASy Swiss-Prot
Match: BCP_BACSU (Putative peroxiredoxin ygaF OS=Bacillus subtilis GN=ygaF PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 6.474e-22
Identity = 52/122 (42.62%), Postives = 72/122 (59.02%), Query Frame = 2
Query:  242 GQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKE---WGVPADFFGSLPG--RQTYVLDK 592
            GQ  P   LK   G  V LS +KGK +V+YFYP D TPGCT +AC FRDS+E F +  A +IG+S D    H  F +K+ LP+ LL D+ +K+ +    W +  +F     G  R T+++DK
Sbjct:    6 GQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDK 127          
The following BLAST results are available for this feature:
BLAST of DN617290 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
PRXQ_POPJC5.567e-8277.95Peroxiredoxin Q, chloroplastic OS=Populus jackii G... [more]
PERQ_SEDLI4.724e-7380.49Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum... [more]
PRXQ_GENTR8.057e-7371.86Peroxiredoxin Q, chloroplastic OS=Gentiana triflor... [more]
PERQ_SUASA3.999e-7270.92Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=... [more]
PRXQ_ARATH1.422e-6976.79Peroxiredoxin Q, chloroplastic OS=Arabidopsis thal... [more]
PRXQ_WHEAT2.776e-6573.65Peroxiredoxin Q, chloroplastic OS=Triticum aestivu... [more]
PRXQ_ORYSJ4.735e-6581.25Peroxiredoxin Q, chloroplastic OS=Oryza sativa sub... [more]
PRXQ_ORYSI4.735e-6581.25Putative peroxiredoxin Q, chloroplastic OS=Oryza s... [more]
BCP_COXBU1.347e-2745.11Putative peroxiredoxin bcp OS=Coxiella burnetii GN... [more]
BCP_BACSU6.474e-2242.62Putative peroxiredoxin ygaF OS=Bacillus subtilis G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A05_f Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617290 ID=DN617290|Name=DN617290|organism=Citrus sinensis|type=EST|length=624bp
TCATCAAGGAGCCTTATCTCTTCCACTCAAATGGGCTGCTTCACTGAATC
TCCCAAAGCACACTCTCCCACCTTTTCTCCCCACTCAAACTCCCAGAACC
CCACCTTCCCAAAGCCTCGCAATTCCCTCCAAATCATCATCACAGTCTCA
ATTTTATGGCCTCGGGTTCTCTTTTTCTTCCAACTTGCCAATCCCATCTT
CCACATCTTTCAAGACTTCCATTTCTGCCAAGGTGAGCAAAGGACAGGCG
CCTCCTTCCTTCACATTGAAAGATCAAGAGGGCAGGAATGTGAGCCTATC
CAAGTTTAAAGGGAAGCCCGTGGTTGTTTATTTTTACCCTGCTGATGAGA
CACCTGGCTGCACCAAACAGGCATGCGCTTTTAGGGATTCTTATGAGAAA
TTTAAGAAAGCAGGAGCTGAGGTTATTGGGATTAGTGGTGATGATTCATC
GTCACACAAGGCATTTGCAAAAAAGTATAGGCTTCCATATACATTGCTGA
GCGACGAGGGTAACAAGGTGAGGAAAGAATGGGGGGTTCCAGCAGACTTC
TTTGGATCATTGCCTGGGAGACAGACTTACGTTCTTGACAAGAATGAAGT
GGTTCAGCTCATCTACAACAACCA
back to top