CX043882

Overview
NameCX043882
Unique NameCX043882
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length864
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2024 contig Csv1_Contig2024:38..900. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX043882 vs. ExPASy Swiss-Prot
Match: TI10A_ARATH (Protein TIFY 10A OS=Arabidopsis thaliana GN=TIFY10A PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.554e-26
Identity = 73/150 (48.67%), Postives = 95/150 (63.33%), Query Frame = 1
Query:  199 EKSSFSQTCSLLSQYLKEGGSFGDLSLGISSNIEANGVPEIPRRPAATTMNLFPVSDNSGQDVSVRNMVAPRNWESMNLFPQQAGFA------PKNDTPNMIDSSLN-KPAPQTAQMTIFYGGQVIAFNDFPADKANEIMQLASNGSSLS 627
            +K SFSQTCS LSQYLKE GSFGDLSLG++   + NG     R+P  TTM+LFP  + S  D  V+++      +  NLFP+Q  F+      PK D   M  ++ + KP  QTA +TIFY GQVI FNDF A+KA E++ LAS G++ S
Sbjct:   19 KKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQP-TTTMSLFP-CEASNMDSMVQDV------KPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANS 160          
BLAST of CX043882 vs. ExPASy Swiss-Prot
Match: TI10B_ARATH (Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10B PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.033e-22
Identity = 70/198 (35.35%), Postives = 102/198 (51.52%), Query Frame = 1
Query:  202 KSSFSQTCSLLSQYLKEGGSFGDLSLGISSNIEANGVPEIPRRPAATTMNLFPVSDNSGQDVSVRNMVAPRNWESMNLFPQQAGFAPKNDTPNMIDSSLNK-------PAPQTAQMTIFYGGQVIAFNDFPADKANEIMQLASNGSSLSHGTAYPPMQLPAQGYNSFAASLPKSPV------ESTPPVSPGPPKILTE 756
            K SFSQTC+ LS+YLKE GSFGDLSLG++   + NG    P     T MNLFP  + SG D S        + +   +FP+Q+ F+  + +    D  + K       P  Q+A +TIFYGG+V+ F+DF A+KA E++ LA+ GS+ S       +      Y+    +   +PV       +  P+ P P  +  E
Sbjct:   15 KPSFSQTCTRLSRYLKEKGSFGDLSLGMTCKPDVNGGSRQP-----TMMNLFPC-EASGMDSSA----GQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAEVNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQPNPASLACE 202          
BLAST of CX043882 vs. ExPASy Swiss-Prot
Match: TI11B_ARATH (Protein TIFY 11B OS=Arabidopsis thaliana GN=TIFY11B PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.040e-14
Identity = 52/149 (34.90%), Postives = 81/149 (54.36%), Query Frame = 1
Query:  196 PEKSSFSQTCSLLSQYLKEGGSFGDLSLGISSNIEANGVPEIPRRPAATTMNLFPVSDNSGQDVSVRNMVA--PRNWESMNLFPQQAGFAPKNDTPNMID-SSLNKPAPQT--AQMTIFYGGQVIAFNDFPADKANEIMQLASNGSSLS 627
            PEKS+FSQ CSLLS+YLKE GSFG++++G++                 + + L    D  GQ   ++ +     R ++ +  F          D    ID S   K AP++  +Q+TIF+GG+V+ FN+FP DKA EIM++A   + ++
Sbjct:    7 PEKSNFSQRCSLLSRYLKEKGSFGNINMGLARK---------------SDLELAGKFDLKGQQNVIKKVETSETRPFKLIQKFSIGEASTSTEDKAIYIDLSEPAKVAPESGNSQLTIFFGGKVMVFNEFPEDKAKEIMEVAKEANHVA 140          
The following BLAST results are available for this feature:
BLAST of CX043882 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
TI10A_ARATH1.554e-2648.67Protein TIFY 10A OS=Arabidopsis thaliana GN=TIFY10... [more]
TI10B_ARATH3.033e-2235.35Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10... [more]
TI11B_ARATH3.040e-1434.90Protein TIFY 11B OS=Arabidopsis thaliana GN=TIFY11... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_14A07_b Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-14A07-B14-1-6.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043882 ID=CX043882; Name=CX043882; organism=Citrus sinensis; type=EST; length=864bp
CCTCGTGTCCAATCAACAGATAAGGCTTTTTCTCCTTACAAATACAGATT
GATCATCCAACAGAACAACTTCACCAATTCAATTCTGCAGCGTCAGTTGC
AGCGCACTAGTTTTATTTTTGCTCGTGGGTTTCCGCTTCTGAGTTGGTTA
AACACAACAAGTATGGCGAGCTCGTCGGAGATGTCGGTTAACTTGCCGGA
GAAATCAAGTTTCTCTCAGACGTGTAGTCTTTTGAGTCAGTACTTGAAAG
AGGGAGGTAGCTTTGGAGATCTTAGCCTCGGGATATCAAGCAACATTGAA
GCTAATGGGGTACCCGAGATCCCGCGGCGGCCAGCAGCTACAACTATGAA
TTTGTTTCCAGTAAGTGACAACTCTGGACAAGATGTTTCAGTTCGAAACA
TGGTGGCTCCTCGAAACTGGGAATCAATGAATTTGTTCCCTCAGCAAGCT
GGTTTTGCTCCTAAGAATGATACCCCTAACATGATAGATTCAAGTTTAAA
CAAGCCCGCGCCGCAAACTGCTCAAATGACTATATTTTATGGCGGACAAG
TGATTGCGTTCAATGATTTTCCTGCTGATAAAGCAAATGAAATCATGCAA
TTAGCAAGCAACGGGAGCTCACTGAGCCATGGTACCGCATATCCTCCTAT
GCAACTGCCGGCCCAGGGTTACAACTCTTTTGCTGCTAGTTTACCCAAAA
GTCCAGTTGAATCAACTCCCCCGGTTTCTCCTGGCCCCCCAAAAATTCTA
ACAGAGCCTAGTTGCTCGGTTCCTCCTCGATCAAATAGCATTCCTAACTT
TGGCAACAATCTAATTCCAGAGTGCGCTCAACCTCCCTCAAGACCTTGTG
ATCTACCAATTGCA
back to top