DC900390

Overview
NameDC900390
Unique NameDC900390
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length603
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5641 contig Csv1_Contig5641:3..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTPA_RICCO (Non-specific lipid-transfer protein A OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.039e-21
Identity = 49/92 (53.26%), Postives = 64/92 (69.57%), Query Frame = 2
Query:  116 ITCGQVDSFLAPCLAYLTGE-GKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            + CGQV+S LA C+ +LTG    PS +CC GV+ LK   PT+ADR+AAC+CIK AA R+  IK D A  LPK+CGVDI +PI+   +C  I+
Sbjct:    1 VDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQAIN 92          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP2_SORBI (Non-specific lipid-transfer protein 2 OS=Sorghum bicolor GN=LTP2 PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.039e-21
Identity = 47/95 (49.47%), Postives = 63/95 (66.32%), Query Frame = 2
Query:  107 QAAITCGQVDSFLAPCLAYLTGEGK-PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            +AA+TCGQV S + PCL+Y  G+G  PS  CC+GV  L     TTADR+AAC C+K+AA   RG+ + KA  +P +CGV I   I+   DCS++S
Sbjct:   28 EAAVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRVS 122          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSJ (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. japonica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.772e-21
Identity = 43/98 (43.88%), Postives = 65/98 (66.33%), Query Frame = 2
Query:   98 ERGQAAITCGQVDSFLAPCLAYLTG-EGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            ER  AA++CG V S +APCL+Y+ G E  PS +CC+GV  L     ++ADR+ AC C+K+ A+ +R + +  A  +P +CGV +  PI+  +DCSKI+
Sbjct:   24 ERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKIN 121          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSI (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. indica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.772e-21
Identity = 43/98 (43.88%), Postives = 65/98 (66.33%), Query Frame = 2
Query:   98 ERGQAAITCGQVDSFLAPCLAYLTG-EGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            ER  AA++CG V S +APCL+Y+ G E  PS +CC+GV  L     ++ADR+ AC C+K+ A+ +R + +  A  +P +CGV +  PI+  +DCSKI+
Sbjct:   24 ERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKIN 121          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSJ (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. japonica GN=LTP PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.794e-21
Identity = 45/92 (48.91%), Postives = 59/92 (64.13%), Query Frame = 2
Query:  113 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            AITCGQV+S + PCL Y  G   PS ACC+GV  LK    TTADR+ AC C+K+AA   +G+    A  +P +CGV +   I+  IDCS++S
Sbjct:   25 AITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS 116          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSI (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. indica GN=LTP PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.794e-21
Identity = 45/92 (48.91%), Postives = 59/92 (64.13%), Query Frame = 2
Query:  113 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            AITCGQV+S + PCL Y  G   PS ACC+GV  LK    TTADR+ AC C+K+AA   +G+    A  +P +CGV +   I+  IDCS++S
Sbjct:   25 AITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS 116          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTPB_ARATH (Non-specific lipid-transfer protein 11 OS=Arabidopsis thaliana GN=LTP11 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.959e-20
Identity = 46/92 (50.00%), Postives = 57/92 (61.96%), Query Frame = 2
Query:  113 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            AI C QV+ +LA CL YL   G PS  CC G+  LK   P  ADRQ AC C+K  A    GI  D A+QLP +CGV+IGVP +  +DC+ I+
Sbjct:   28 AIACPQVNMYLAQCLPYLKAGGNPSPMCCNGLNSLKAAAPEKADRQVACNCLKSVANTIPGINDDFAKQLPAKCGVNIGVPFSKTVDCNSIN 119          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP3_HORVU (Non-specific lipid-transfer protein 3 OS=Hordeum vulgare GN=LTP3 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.959e-20
Identity = 45/93 (48.39%), Postives = 63/93 (67.74%), Query Frame = 2
Query:  110 AAITCGQVDSFLAPCLAYLTGEG-KPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            AAI+CGQV S L+PC++Y  G G KP  ACC+GV+ L     +TAD+QAAC+C+K  AT  +GI + K   +P +CGV +  PI+   DC+K+
Sbjct:   25 AAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKV 117          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP2_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica GN=LTP2-A PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.559e-20
Identity = 44/93 (47.31%), Postives = 59/93 (63.44%), Query Frame = 2
Query:  110 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            AAI+CGQV+S ++PCL+Y  G   PS ACC+GV  L     TTADR+ AC C+K+ A    G+    A  +P +CGV I   I+P IDCS ++
Sbjct:   26 AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN 118          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLT2B_ORYSJ (Non-specific lipid-transfer protein 2B OS=Oryza sativa subsp. japonica GN=LTP2-B PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.559e-20
Identity = 44/93 (47.31%), Postives = 59/93 (63.44%), Query Frame = 2
Query:  110 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            AAI+CGQV+S ++PCL+Y  G   PS ACC+GV  L     TTADR+ AC C+K+ A    G+    A  +P +CGV I   I+P IDCS ++
Sbjct:   25 AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN 117          
The following BLAST results are available for this feature:
BLAST of DC900390 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
NLTPA_RICCO1.039e-2153.26Non-specific lipid-transfer protein A OS=Ricinus c... [more]
NLTP2_SORBI1.039e-2149.47Non-specific lipid-transfer protein 2 OS=Sorghum b... [more]
NLTP3_ORYSJ1.772e-2143.88Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP3_ORYSI1.772e-2143.88Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP1_ORYSJ8.794e-2148.91Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]
NLTP1_ORYSI8.794e-2148.91Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]
NLTPB_ARATH1.959e-2050.00Non-specific lipid-transfer protein 11 OS=Arabidop... [more]
NLTP3_HORVU1.959e-2048.39Non-specific lipid-transfer protein 3 OS=Hordeum v... [more]
NLTP2_ORYSI2.559e-2047.31Non-specific lipid-transfer protein 2 OS=Oryza sat... [more]
NLT2B_ORYSJ2.559e-2047.31Non-specific lipid-transfer protein 2B OS=Oryza sa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900390 VSS Citrus sinensis cDNA clone VS28963 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900390 ID=DC900390|Name=DC900390|organism=Citrus sinensis|type=EST|length=603bp
AAACACCAAACACCTTCAAAATCCTCCAGCATTATTAGAAAACATGAAAG
CCGGTGTGGTTCTTGCTGTGATGTTACTGGCAGCGATCGTCATGGTGGAG
CGAGGCCAGGCAGCTATAACCTGCGGCCAAGTCGACTCCTTTCTAGCTCC
TTGCTTGGCATATCTGACCGGGGAAGGCAAGCCATCTCGGGCATGCTGCA
CTGGTGTCGAGTATCTGAAAGACAACACTCCAACAACTGCAGACAGGCAA
GCTGCTTGTAAATGCATCAAAGATGCGGCAACTCGCTATCGCGGCATCAA
GCTGGACAAAGCTCGTCAACTCCCCAAAGAATGTGGCGTCGACATCGGCG
TTCCCATCACCCCCGATATCGACTGTAGCAAAATTTCTTAGAACCCCCCA
CGGAGGCTTTGAGCTTGTGCGTTGAATAAACATCTCTGCCAGCTGGAGAA
AACACAGCACAATTAATATACATGAGCTAATTAAGCTTGTTAATTTATGC
TGCTTGTTATGGTTCTTGCTGAAGAACTTTTTGTATCGGGATACTTTTAG
TGCATGGTGTTTTAGCACATAATTAGCGTTAATAAAACGAGAGTTATTAC
CTC
back to top