DC900385

Overview
NameDC900385
Unique NameDC900385
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length556
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900385_ssr488 microsatellite DC900385_ssr488:488..502. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9024 contig Csv1_Contig9024:733..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOX6_ARATH (Lipoxygenase 6, choloroplastic OS=Arabidopsis thaliana GN=LOX6 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.230e-21
Identity = 42/57 (73.68%), Postives = 47/57 (82.46%), Query Frame = 1
Query:  118 FDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            F+KFS  L +IEK IN RNKD +LK R GAG+PPYELLLP+S  GVTGRGIPNSISI
Sbjct:  861 FNKFSEELVKIEKTINERNKDKKLKNRTGAGMPPYELLLPTSPHGVTGRGIPNSISI 917          

HSP 2 Score: 36.1946 bits (82), Expect = 3.230e-21
Identity = 13/25 (52.00%), Postives = 18/25 (72.00%), Query Frame = 2
Query:   35 THSPDEEYLGQVNQLHSHWINDPEV 109
            THSPDEEYL ++ ++  HW  D +V
Sbjct:  833 THSPDEEYLIELREVQRHWFQDEQV 857          
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOX4_ARATH (Lipoxygenase 4, chloroplastic OS=Arabidopsis thaliana GN=LOX4 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.375e-16
Identity = 34/60 (56.67%), Postives = 44/60 (73.33%), Query Frame = 1
Query:  109 LNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            ++ F  FSA +  IEK I+ RN+D   + RCGAG+ PYEL+ PSS PGVT RG+PNS+SI
Sbjct:  867 VDAFYGFSAEIGRIEKEIDKRNRDPSRRNRCGAGVLPYELMAPSSEPGVTCRGVPNSVSI 926          

HSP 2 Score: 31.5722 bits (70), Expect = 7.375e-16
Identity = 14/25 (56.00%), Postives = 17/25 (68.00%), Query Frame = 2
Query:   35 THSPDEEYLGQVNQLHSHWINDPEV 109
            THSPDEEY+G+  Q  S W  D E+
Sbjct:  843 THSPDEEYIGE-RQQPSIWTGDAEI 866          
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.591e-16
Identity = 38/57 (66.67%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  118 FDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            F+KFS  L+E E  I+ RN +   K RCGAGI PYELL P S PGVTGRGIPNSISI
Sbjct:  840 FEKFSGRLKEAEGTIDMRNNNPENKNRCGAGIVPYELLKPFSEPGVTGRGIPNSISI 896          

HSP 2 Score: 26.9498 bits (58), Expect = 9.591e-16
Identity = 11/25 (44.00%), Postives = 17/25 (68.00%), Query Frame = 2
Query:   35 THSPDEEYLGQVNQLHSHWINDPEV 109
            +HSPDEEY+G+  +    W+ +P V
Sbjct:  814 SHSPDEEYMGEYAE--PAWLAEPMV 836          
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOX3_ARATH (Lipoxygenase 3, chloroplastic OS=Arabidopsis thaliana GN=LOX3 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.733e-15
Identity = 34/57 (59.65%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  118 FDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            F  F+A +  IEK I  RN D   + RCGAG+ PYELL+PSS PGVT RG+PNS+SI
Sbjct:  863 FYGFAAEIGRIEKEIEKRNADPDRRNRCGAGVLPYELLVPSSEPGVTCRGVPNSVSI 919          

HSP 2 Score: 31.5722 bits (70), Expect = 2.733e-15
Identity = 14/25 (56.00%), Postives = 17/25 (68.00%), Query Frame = 2
Query:   35 THSPDEEYLGQVNQLHSHWINDPEV 109
            THSPDEEY+G+  Q  S W  D E+
Sbjct:  836 THSPDEEYIGE-RQQPSIWTGDAEI 859          
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 3.745e-14
Identity = 36/57 (63.16%), Postives = 44/57 (77.19%), Query Frame = 1
Query:  118 FDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            +D F+A L+EIE +I+ RNKD +LK RCGAGI PY+L+ P S  GVTG GIPNS SI
Sbjct:  868 YDGFAARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDSGVTGMGIPNSTSI 924          

HSP 2 Score: 21.9422 bits (45), Expect = 3.745e-14
Identity = 8/10 (80.00%), Postives = 9/10 (90.00%), Query Frame = 2
Query:   35 THSPDEEYLG 64
            +HS DEEYLG
Sbjct:  842 SHSTDEEYLG 851          
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOX6_ORYSJ (Probable lipoxygenase 6 OS=Oryza sativa subsp. japonica GN=Os03g0179900 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 6.320e-14
Identity = 33/54 (61.11%), Postives = 39/54 (72.22%), Query Frame = 1
Query:  127 FSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            F+A++   E+ I  RN D   K RCGAG+ PYELL PSS PGVT RG+PNSISI
Sbjct:  865 FAADVRRAEETIERRNADHGRKNRCGAGVLPYELLAPSSPPGVTCRGVPNSISI 918          

HSP 2 Score: 27.335 bits (59), Expect = 6.320e-14
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 2
Query:   35 THSPDEEYLGQ 67
            THSPDEEYLG+
Sbjct:  833 THSPDEEYLGE 843          
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.205e-14
Identity = 35/54 (64.81%), Postives = 42/54 (77.78%), Query Frame = 1
Query:  127 FSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            F+A L+EIE +I+ RNKD +LK RCGAGI PY+L+ P S  GVTG GIPNS SI
Sbjct:  888 FTARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDAGVTGMGIPNSTSI 941          

HSP 2 Score: 23.483 bits (49), Expect = 8.205e-14
Identity = 9/10 (90.00%), Postives = 9/10 (90.00%), Query Frame = 2
Query:   35 THSPDEEYLG 64
            THS DEEYLG
Sbjct:  859 THSTDEEYLG 868          
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOX2_ARATH (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana GN=LOX2 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.036e-13
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 1
Query:  118 FDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            F++F   L+ +E +I+ RN +  LK R GAG+  YELL P+S  GVTG G+P SISI
Sbjct:  840 FERFKGKLQYLEGVIDERNVNITLKNRAGAGVVKYELLKPTSEHGVTGMGVPYSISI 896          

HSP 2 Score: 32.7278 bits (73), Expect = 3.036e-13
Identity = 13/25 (52.00%), Postives = 18/25 (72.00%), Query Frame = 2
Query:   35 THSPDEEYLGQVNQLHSHWINDPEV 109
            THSPDEEY+G+  Q  + W N+P +
Sbjct:  814 THSPDEEYIGE--QQEASWANEPVI 836          
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOX5_ORYSJ (Putative lipoxygenase 5 OS=Oryza sativa subsp. japonica GN=Os04g0447100 PE=3 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 6.649e-13
Identity = 31/63 (49.21%), Postives = 44/63 (69.84%), Query Frame = 1
Query:  100 P*SLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            P +L    +F+A++   E+ I  RN D   + RCGAG+ PYEL+ PSSGPG+T RG+PNS++I
Sbjct:  837 PAALAAAREFAADVRRAEEEIERRNADPSRRNRCGAGVLPYELMAPSSGPGITCRGVPNSVTI 899          

HSP 2 Score: 25.409 bits (54), Expect = 6.649e-13
Identity = 12/23 (52.17%), Postives = 14/23 (60.87%), Query Frame = 2
Query:   35 THSPDEEYLGQVNQLHSHWINDP 103
            THS DEEYLG+  +    W  DP
Sbjct:  817 THSADEEYLGE--RPDEAWTADP 837          
BLAST of DC900385 vs. ExPASy Swiss-Prot
Match: LOX1_ARATH (Lipoxygenase 1 OS=Arabidopsis thaliana GN=LOX1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 5.378e-12
Identity = 35/61 (57.38%), Postives = 41/61 (67.21%), Query Frame = 1
Query:  106 SLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 288
            +L  F+KF   ++EIEK I+ RN D  LK R G    PY LL PSS  GVTGRGIPNS+SI
Sbjct:  799 ALEAFEKFGEKVKEIEKNIDERNDDETLKNRTGLVKMPYTLLFPSSEGGVTGRGIPNSVSI 859          

HSP 2 Score: 22.7126 bits (47), Expect = 5.378e-12
Identity = 9/11 (81.82%), Postives = 9/11 (81.82%), Query Frame = 2
Query:   35 THSPDEEYLGQ 67
            THS DE YLGQ
Sbjct:  777 THSSDEVYLGQ 787          
The following BLAST results are available for this feature:
BLAST of DC900385 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
LOX6_ARATH3.230e-2173.68Lipoxygenase 6, choloroplastic OS=Arabidopsis thal... [more]
LOX4_ARATH7.375e-1656.67Lipoxygenase 4, chloroplastic OS=Arabidopsis thali... [more]
LOX23_HORVU9.591e-1666.67Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare... [more]
LOX3_ARATH2.733e-1559.65Lipoxygenase 3, chloroplastic OS=Arabidopsis thali... [more]
LOXC1_ORYSJ3.745e-1463.16Lipoxygenase 7, chloroplastic OS=Oryza sativa subs... [more]
LOX6_ORYSJ6.320e-1461.11Probable lipoxygenase 6 OS=Oryza sativa subsp. jap... [more]
LOXC2_ORYSJ8.205e-1464.81Probable lipoxygenase 8, chloroplastic OS=Oryza sa... [more]
LOX2_ARATH3.036e-1350.88Lipoxygenase 2, chloroplastic OS=Arabidopsis thali... [more]
LOX5_ORYSJ6.649e-1349.21Putative lipoxygenase 5 OS=Oryza sativa subsp. jap... [more]
LOX1_ARATH5.378e-1257.38Lipoxygenase 1 OS=Arabidopsis thaliana GN=LOX1 PE=... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900385 VSS Citrus sinensis cDNA clone VS28959 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900385 ID=DC900385|Name=DC900385|organism=Citrus sinensis|type=EST|length=556bp
ACTCAACACTAAGTATGCTGTCAAGCACTCTGTCACTCACTCTCCTGATG
AAGAGTATCTAGGTCAGGTGAACCAGTTACACAGCCACTGGATCAATGAC
CCTGAAGTTTGAATATGTTTGATAAGTTCTCTGCTAATCTGGAGGAGATT
GAAAAGATAATAAATACAAGAAATAAAGATTTCCGTCTTAAAGGCAGATG
TGGTGCTGGCATTCCACCATATGAACTGCTTCTTCCTTCCTCTGGTCCGG
GAGTAACTGGTCGAGGAATCCCCAATAGTATTTCTATCTGATGGACTTAG
CTAAATTGAGACACTGGTAGATGCCTTTTTGTCACTATCGGTTAGTGCAT
ACCATTTTATTTCTGTGCTGTGCGGTTGTATGGACCTTCAATAGATCTTT
TGGGGTTCGGTATTTGATATTAAAGCTCTGTAATTTGTGGGTAAAAGATA
TGATAGGACACAGAAAACTTGGAATATCATGATATTGGATCTGATCTGAT
CTTTGTAAAGCAACATATAAGATGCTGCAACTTATATTGAACATATCGTT
TTCTGA
back to top