DC900384

Overview
NameDC900384
Unique NameDC900384
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length458
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig649 contig Csv1_Contig649:620..1077. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOX6_ARATH (Lipoxygenase 6, choloroplastic OS=Arabidopsis thaliana GN=LOX6 PE=1 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 4.318e-64
Identity = 116/140 (82.86%), Postives = 128/140 (91.43%), Query Frame = 3
Query:    3 INSLPD--RKTYASRTVFFYNKAGMLRPLAIELSLPPTRSSPQNKHIYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASFSP 416
            INS+ +  RKTYASRT+FFY+K G LRPLAIELSLPPT  S +NK +YTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWL THASMEPYIIAT+RQLS+MHP+YKLLHPHMRYTLEINA AR+SLINGGGIIE+ F+P
Sbjct:  497 INSIKEDPRKTYASRTIFFYSKNGALRPLAIELSLPPTAES-ENKFVYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLRTHASMEPYIIATNRQLSTMHPVYKLLHPHMRYTLEINARARKSLINGGGIIESCFTP 635          
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOX6_ORYSJ (Probable lipoxygenase 6 OS=Oryza sativa subsp. japonica GN=Os03g0179900 PE=2 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 1.441e-51
Identity = 92/139 (66.19%), Postives = 115/139 (82.73%), Query Frame = 3
Query:    3 INSLPDRKTYASRTVFFYNKAGMLRPLAIELSLPPTR-SSPQNKHIYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASFSP 416
            IN++  RK YA+RT+FF  +AG L+P+AIELSLPP +   P+   + T  +DAT++W+W LAKAHV SNDAGVHQLVNHWL THA+MEP+I+A HR +S+MHPI+KLLHPHMRYTLEINALARQSLIN  G+IE+ F+P
Sbjct:  495 INAIDGRKAYATRTIFFLTEAGTLKPIAIELSLPPAKPGEPRPSKVLTPPYDATSNWLWMLAKAHVSSNDAGVHQLVNHWLRTHATMEPFILAAHRHMSAMHPIFKLLHPHMRYTLEINALARQSLINADGVIESCFTP 633          
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOX3_ARATH (Lipoxygenase 3, chloroplastic OS=Arabidopsis thaliana GN=LOX3 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 7.905e-50
Identity = 93/147 (63.27%), Postives = 116/147 (78.91%), Query Frame = 3
Query:    3 INSLPDRKTYASRTVFFYNKAGMLRPLAIELSLPPTRSSPQNKHIYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASFSPEGCHGASLS 443
            IN+L  RK YA+RT+FF  + G L+P+AIELSLPP     ++K + T   DAT++W+W+LAKAHV SNDAGVHQLVNHWL THA +EP+I+A HRQLS+MHPI+KLL PHMRYTLEINALARQSLI+  G+IE  F+  G +G  +S
Sbjct:  501 INALDGRKAYATRTIFFLTRLGTLKPVAIELSLPPHGPKHRSKRVLTPPVDATSNWMWQLAKAHVSSNDAGVHQLVNHWLRTHACLEPFILAAHRQLSAMHPIFKLLDPHMRYTLEINALARQSLISADGVIEGGFT-AGAYGMEMS 646          
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOX5_ORYSJ (Putative lipoxygenase 5 OS=Oryza sativa subsp. japonica GN=Os04g0447100 PE=3 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 1.348e-49
Identity = 91/139 (65.47%), Postives = 111/139 (79.86%), Query Frame = 3
Query:    3 INSLPDRKTYASRTVFFYNKAGMLRPLAIELSLPP-TRSSPQNKHIYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASFSP 416
            IN+   RK Y +R VFF   AG L+P+AIEL LPP T    + K ++T   DAT++W+W+LAKAHVCSNDAGVHQL+NHWL THA MEP+IIA HRQ+S+MHPI+KLL PHMRYTL+INALARQ LING G+IE+ F+P
Sbjct:  481 INAQDGRKAYGTRAVFFLTAAGTLKPIAIELCLPPMTDGCKRAKRVFTPPADATSNWLWQLAKAHVCSNDAGVHQLINHWLRTHACMEPFIIAAHRQMSAMHPIFKLLKPHMRYTLKINALARQILINGDGVIESGFTP 619          
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 7.399e-48
Identity = 87/136 (63.97%), Postives = 105/136 (77.21%), Query Frame = 3
Query:    3 INSLPDRKTYASRTVFFYNKAGMLRPLAIELSLPPTRSSPQNKHIYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASF 410
            +  LPD   Y SRTVFF +  G L PLAIEL+ P + + PQ K  +THG DAT  W+WKLAKAHV ++D G HQLV+HWL THA +EPYIIAT+RQLS MHP+Y+LLHPH RYT+EINALAR++LIN  GIIE +F
Sbjct:  479 VRELPDTTLYGSRTVFFLSDEGTLMPLAIELTRPQSPTKPQWKRAFTHGSDATESWLWKLAKAHVLTHDTGYHQLVSHWLRTHACVEPYIIATNRQLSRMHPVYRLLHPHFRYTMEINALAREALINADGIIEEAF 614          
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOX4_ARATH (Lipoxygenase 4, chloroplastic OS=Arabidopsis thaliana GN=LOX4 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.153e-47
Identity = 92/148 (62.16%), Postives = 117/148 (79.05%), Query Frame = 3
Query:    3 INSLPDRKTYASRTVFFYNKAGMLRPLAIELSLPPTRSSPQ-NKHIYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASFSPEGCHGASLS 443
            IN+L  RK YA+RT+ F  + G L+P+AIELSLP   SS Q +K + T   DAT++W+W+LAKAHV SNDAGVHQLVNHWL THA +EP+I+A HRQLS+MHPI+KLL PHMRYTLEINA+ARQ+LI+  G+IE+ F+  G +G  +S
Sbjct:  507 INALDGRKAYATRTILFLTRLGTLKPIAIELSLPSQSSSNQKSKRVVTPPVDATSNWMWQLAKAHVGSNDAGVHQLVNHWLRTHACLEPFILAAHRQLSAMHPIFKLLDPHMRYTLEINAVARQTLISADGVIESCFT-AGQYGLEIS 653          
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOX2_ARATH (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana GN=LOX2 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 8.181e-47
Identity = 85/138 (61.59%), Postives = 105/138 (76.09%), Query Frame = 3
Query:    3 INSLPDRKTYASRTVFFYNKAGMLRPLAIELSLPPTRSSPQNKHIYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASFSP 416
            +  L +   YASRT+FF +    LRP+AIEL+ PP  + PQ K ++T G+DAT+ W+W LAK H  S+DAG HQL++HWL THA  EPYIIA +RQLS+MHPIY+LLHPH RYT+EINA ARQSL+NGGGIIE  F P
Sbjct:  477 VRELNNTTLYASRTLFFLSDDSTLRPVAIELTCPPNINKPQWKQVFTPGYDATSCWLWNLAKTHAISHDAGYHQLISHWLRTHACTEPYIIAANRQLSAMHPIYRLLHPHFRYTMEINARARQSLVNGGGIIETCFWP 614          
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 2.085e-42
Identity = 80/139 (57.55%), Postives = 100/139 (71.94%), Query Frame = 3
Query:    3 INSLPDRKTYASRTVFFYNKAGMLRPLAIELSLPPTRSSPQNKHIYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASFSPE 419
            I SL     Y SRT+FF    G LR LAIEL+ P + S PQ + ++T   D T  W+W++AKAHV ++DAG H+L+ HWL TH ++EPYIIA +RQLS MHPIY+LLHPH RYT+ INALAR  LI+  GIIE SFSP+
Sbjct:  521 IRSLKHTTMYGSRTIFFLTDDGTLRLLAIELTRPASPSQPQWRQVFTPSTDTTKSWLWRMAKAHVRAHDAGHHELITHWLRTHCAVEPYIIAANRQLSEMHPIYQLLHPHFRYTMRINALARSRLISAAGIIELSFSPQ 659          
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOX21_HORVU (Lipoxygenase 2.1, chloroplastic OS=Hordeum vulgare GN=LOX2.1 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.723e-42
Identity = 80/140 (57.14%), Postives = 100/140 (71.43%), Query Frame = 3
Query:    3 INSLPDRKTYASRTVFFYNKAGMLRPLAIELSLPPTRSSPQNKHIYTHGHDA--TTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASFSP 416
            +  L     Y SR +FF    G LRP+AIEL+ P ++  PQ + ++T G D   T  W+W+LAKAH+ ++DAGVHQLV+HWL THA  EPYIIA +RQLS MHP+Y+LLHPH R+T+EINA AR  LIN GGIIE SF P
Sbjct:  508 VRKLDGTTLYGSRALFFLTADGTLRPIAIELTRPKSKKKPQWRQVFTPGCDGSVTGSWLWQLAKAHILAHDAGVHQLVSHWLRTHACTEPYIIAANRQLSQMHPVYRLLHPHFRFTMEINAQARAMLINAGGIIEGSFVP 647          
BLAST of DC900384 vs. ExPASy Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 7.924e-42
Identity = 80/139 (57.55%), Postives = 101/139 (72.66%), Query Frame = 3
Query:    3 INSLPDRKTYASRTVFFYNKAGMLRPLAIELSLPPTRSSPQNKHIYTHGHDATTHWIWKLAKAHVCSNDAGVHQLVNHWLMTHASMEPYIIATHRQLSSMHPIYKLLHPHMRYTLEINALARQSLINGGGIIEASFSPE 419
            I SL     Y SRTVFF    G L+ LAIEL+ P + S PQ + ++T   DAT  W+W++AKAHV ++DAG H+L+ HWL TH ++EPYIIA +RQLS MHPIY+LL PH RYT+ INA AR +LI+ GGIIE SFSP+
Sbjct:  504 IRSLDHTTMYGSRTVFFLTDDGTLQLLAIELTRPASPSQPQWRQVFTPSTDATMSWLWRMAKAHVRAHDAGHHELITHWLRTHCAVEPYIIAANRQLSEMHPIYQLLRPHFRYTMRINARARSALISAGGIIERSFSPQ 642          
The following BLAST results are available for this feature:
BLAST of DC900384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
LOX6_ARATH4.318e-6482.86Lipoxygenase 6, choloroplastic OS=Arabidopsis thal... [more]
LOX6_ORYSJ1.441e-5166.19Probable lipoxygenase 6 OS=Oryza sativa subsp. jap... [more]
LOX3_ARATH7.905e-5063.27Lipoxygenase 3, chloroplastic OS=Arabidopsis thali... [more]
LOX5_ORYSJ1.348e-4965.47Putative lipoxygenase 5 OS=Oryza sativa subsp. jap... [more]
LOX23_HORVU7.399e-4863.97Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare... [more]
LOX4_ARATH2.153e-4762.16Lipoxygenase 4, chloroplastic OS=Arabidopsis thali... [more]
LOX2_ARATH8.181e-4761.59Lipoxygenase 2, chloroplastic OS=Arabidopsis thali... [more]
LOXC2_ORYSJ2.085e-4257.55Probable lipoxygenase 8, chloroplastic OS=Oryza sa... [more]
LOX21_HORVU2.723e-4257.14Lipoxygenase 2.1, chloroplastic OS=Hordeum vulgare... [more]
LOXC1_ORYSJ7.924e-4257.55Lipoxygenase 7, chloroplastic OS=Oryza sativa subs... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900384 VSS Citrus sinensis cDNA clone VS28959 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900384 ID=DC900384|Name=DC900384|organism=Citrus sinensis|type=EST|length=458bp
AAATAAACTCCTTGCCAGATAGAAAAACATATGCCTCTAGGACAGTTTTC
TTCTATAACAAGGCTGGCATGCTGAGGCCACTAGCTATAGAGCTATCCCT
TCCTCCAACACGTTCTTCGCCTCAGAATAAACACATTTACACTCATGGGC
ATGATGCTACAACACATTGGATTTGGAAGCTGGCCAAAGCTCATGTCTGT
TCAAATGATGCTGGAGTCCACCAACTAGTAAATCACTGGTTGATGACTCA
TGCTTCTATGGAGCCTTATATAATTGCAACACACAGACAGCTTAGTTCAA
TGCACCCCATTTATAAGTTGCTTCATCCTCACATGCGCTACACGCTAGAA
ATTAATGCACTTGCACGGCAAAGTTTAATAAACGGAGGGGGTATAATTGA
GGCTTCTTTCAGCCCGGAAGGTTGCCATGGAGCTAGCTTGAGCNCAAGTT
GAGTGCTG
back to top