DC900381

Overview
NameDC900381
Unique NameDC900381
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length656
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10814 contig Csv1_Contig10814:273..927. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UBC13_ARATH (Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana GN=UBC13 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.595e-38
Identity = 71/81 (87.65%), Postives = 78/81 (96.30%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRSQEM 276
            +GRVCISILHPPGDDP+GYELASERW PVHTVESI+LSIISMLSGPNDESPANVEAAKEWR++RD+FKKKV  CVR+SQEM
Sbjct:   85 DGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPNDESPANVEAAKEWREKRDEFKKKVSRCVRKSQEM 165          

HSP 2 Score: 26.9498 bits (58), Expect = 1.595e-38
Identity = 8/10 (80.00%), Postives = 10/10 (100.00%), Query Frame = 3
Query:    6 EIWHPNVYPE 35
            +IWHPNVYP+
Sbjct:   76 DIWHPNVYPD 85          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UBC7_ARATH (Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis thaliana GN=UBC7 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.016e-37
Identity = 72/81 (88.89%), Postives = 78/81 (96.30%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRSQEM 276
            +GRVCISILHPPGDDP+GYELASERW PVHTVESI+LSIISMLSGPNDESPANVEAAKEWRD+RD+FKKKV  CVR+SQEM
Sbjct:   85 DGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPNDESPANVEAAKEWRDKRDEFKKKVSRCVRKSQEM 165          

HSP 2 Score: 22.7126 bits (47), Expect = 1.016e-37
Identity = 6/10 (60.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:    6 EIWHPNVYPE 35
            ++WHPNVY +
Sbjct:   76 DMWHPNVYSD 85          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UBC14_ARATH (Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis thaliana GN=UBC14 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 2.247e-37
Identity = 72/82 (87.80%), Postives = 77/82 (93.90%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRSQEML 279
            +G+VCISILHPPGDDP+GYELASERW PVHTVESIVLSIISMLSGPNDESPANVEAAKEWRD R +F+KKV  CVRRSQEML
Sbjct:   86 DGKVCISILHPPGDDPHGYELASERWTPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDNRAEFRKKVSRCVRRSQEML 167          

HSP 2 Score: 23.8682 bits (50), Expect = 2.247e-37
Identity = 7/10 (70.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:    6 EIWHPNVYPE 35
            E+WHPNVY +
Sbjct:   77 EMWHPNVYSD 86          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UBC7_WHEAT (Ubiquitin-conjugating enzyme E2 7 OS=Triticum aestivum GN=UBC7 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.403e-33
Identity = 68/82 (82.93%), Postives = 76/82 (92.68%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRSQEML 279
            +GRVCISI HPPGDDPNGYELASERW PVHTVESIVLSIISMLS PNDESPAN+EAAK+WR+++D+FKKKV   VR+SQEML
Sbjct:   88 DGRVCISI-HPPGDDPNGYELASERWTPVHTVESIVLSIISMLSSPNDESPANIEAAKDWREKQDEFKKKVRRAVRKSQEML 168          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UBC15_SCHPO (Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe GN=ubc15 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.496e-28
Identity = 55/82 (67.07%), Postives = 68/82 (82.93%), Query Frame = 1
Query:   34 NGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRSQEML 279
            NG VCISILHPPGDD  GYE A ERW+PVH+ E+I++S+ISMLS PNDESPAN++AAKE+R+   +FKK+V   VRRS EM+
Sbjct:   86 NGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILISVISMLSSPNDESPANIDAAKEFRENPQEFKKRVRRLVRRSIEMI 167          

HSP 2 Score: 25.409 bits (54), Expect = 7.496e-28
Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = 3
Query:    6 EIWHPNVYP 32
            EIWHPNV+P
Sbjct:   77 EIWHPNVHP 85          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2G1_RAT (Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 119.398 bits (298), Expect = 1.047e-26
Identity = 54/82 (65.85%), Postives = 68/82 (82.93%), Query Frame = 1
Query:   31 RNGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWR-DRRDDFKKKVGXCVRRSQE 273
            +NG VCISILH PG+D  GYE   ERW+P+HTVE+I++S+ISML+ PN +SPANV+AAKEWR DR  +FK+KV  CVR+SQE
Sbjct:   85 KNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166          

HSP 2 Score: 21.9422 bits (45), Expect = 1.047e-26
Identity = 7/7 (100.00%), Postives = 7/7 (100.00%), Query Frame = 3
Query:    6 EIWHPNV 26
            EIWHPNV
Sbjct:   77 EIWHPNV 83          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2G1_MOUSE (Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 119.398 bits (298), Expect = 1.047e-26
Identity = 54/82 (65.85%), Postives = 68/82 (82.93%), Query Frame = 1
Query:   31 RNGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWR-DRRDDFKKKVGXCVRRSQE 273
            +NG VCISILH PG+D  GYE   ERW+P+HTVE+I++S+ISML+ PN +SPANV+AAKEWR DR  +FK+KV  CVR+SQE
Sbjct:   85 KNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166          

HSP 2 Score: 21.9422 bits (45), Expect = 1.047e-26
Identity = 7/7 (100.00%), Postives = 7/7 (100.00%), Query Frame = 3
Query:    6 EIWHPNV 26
            EIWHPNV
Sbjct:   77 EIWHPNV 83          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2G1_HUMAN (Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3)

HSP 1 Score: 119.398 bits (298), Expect = 1.047e-26
Identity = 54/82 (65.85%), Postives = 68/82 (82.93%), Query Frame = 1
Query:   31 RNGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWR-DRRDDFKKKVGXCVRRSQE 273
            +NG VCISILH PG+D  GYE   ERW+P+HTVE+I++S+ISML+ PN +SPANV+AAKEWR DR  +FK+KV  CVR+SQE
Sbjct:   85 KNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166          

HSP 2 Score: 21.9422 bits (45), Expect = 1.047e-26
Identity = 7/7 (100.00%), Postives = 7/7 (100.00%), Query Frame = 3
Query:    6 EIWHPNV 26
            EIWHPNV
Sbjct:   77 EIWHPNV 83          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2G1_MACFA (Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 6.634e-26
Identity = 53/82 (64.63%), Postives = 67/82 (81.71%), Query Frame = 1
Query:   31 RNGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWR-DRRDDFKKKVGXCVRRSQE 273
            +NG VCISILH PG+D  GYE    RW+P+HTVE+I++S+ISML+ PN +SPANV+AAKEWR DR  +FK+KV  CVR+SQE
Sbjct:   85 KNGDVCISILHEPGEDKYGYEKPEGRWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166          

HSP 2 Score: 21.9422 bits (45), Expect = 6.634e-26
Identity = 7/7 (100.00%), Postives = 7/7 (100.00%), Query Frame = 3
Query:    6 EIWHPNV 26
            EIWHPNV
Sbjct:   77 EIWHPNV 83          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UBC7_CAEEL (Probable ubiquitin-conjugating enzyme E2 7 OS=Caenorhabditis elegans GN=ubc-7 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.482e-25
Identity = 55/81 (67.90%), Postives = 64/81 (79.01%), Query Frame = 1
Query:   31 RNGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDRRDDFKKKVGXCVRRSQE 273
            + G VCISILH PGDD  GYE   ERW+PVHTVE+I+LS+ISML+ PN ESPANV+AAK  R+   +FKKKV  CVRRSQE
Sbjct:   83 KEGNVCISILHDPGDDKWGYERPEERWLPVHTVETILLSVISMLTDPNFESPANVDAAKMQRENYAEFKKKVAQCVRRSQE 163          

HSP 2 Score: 21.9422 bits (45), Expect = 2.482e-25
Identity = 7/10 (70.00%), Postives = 8/10 (80.00%), Query Frame = 3
Query:    6 EIWHPNVYPE 35
            EIWHPN+  E
Sbjct:   75 EIWHPNIDKE 84          
The following BLAST results are available for this feature:
BLAST of DC900381 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
UBC13_ARATH1.595e-3887.65Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis ... [more]
UBC7_ARATH1.016e-3788.89Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis t... [more]
UBC14_ARATH2.247e-3787.80Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis ... [more]
UBC7_WHEAT1.403e-3382.93Ubiquitin-conjugating enzyme E2 7 OS=Triticum aest... [more]
UBC15_SCHPO7.496e-2867.07Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccha... [more]
UB2G1_RAT1.047e-2665.85Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norve... [more]
UB2G1_MOUSE1.047e-2665.85Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus... [more]
UB2G1_HUMAN1.047e-2665.85Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens... [more]
UB2G1_MACFA6.634e-2664.63Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fasci... [more]
UBC7_CAEEL2.482e-2567.90Probable ubiquitin-conjugating enzyme E2 7 OS=Caen... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900381 VSS Citrus sinensis cDNA clone VS28953 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900381 ID=DC900381|Name=DC900381|organism=Citrus sinensis|type=EST|length=656bp
CACCAGAGATTTGGCATCCTAATGTCTATCCGGAATGGGCGTGTCTGCAT
ATCAATCCTTCATCCTCCAGGTGACGACCCTAATGGATATGAGCTTGCAA
GTGAGCGCTGGATGCCTGTTCATACTGTTGAAAGTATCGTTTTGAGTATC
ATATCAATGCTTTCCGGTCCTAATGATGAATCTCCTGCAAATGTCGAAGC
TGCAAAAGAATGGAGAGACAGGAGAGATGACTTCAAGAAGAAAGTAGGCC
NCTGTGTGAGAAGATCNCAAGAAATGTTGTAATCCAACTGCAGGCACTCT
TTTTTTCTCTACCTATGTGTTTGTACGGGAAATGTCTTGATTTAATTGTG
TGGGGGGAACTGGGTTCTGTGGGTAATGTCAATGTGCTTGGTCTTGTGTA
GACTGGCATTTTGAAGTTCTCTCAACCATCTCTCTCGTTTTCTCTGCATG
GTCAAGTCNCTGTAACGACTGGGAACATCCATGTATTCAAAAGCGNNNTT
TGGTTAGTTTTAATCNCAAATGTTCTGTCATTCTCTTAAGTTCGTGTGGA
GATTGCTCTACTCAGAATGGCTTGTGGTTTGATTTCAAAAGGATTCCCCC
GTGATATTTGCTGCTTTTGAATCTTACCGAGCCCNCAAGCATTAGATGTT
TTCTTT
back to top